Clone BS32351 Report

Search the DGRC for BS32351

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:323
Well:51
Vector:pDNR-Dual
Associated Gene/TranscriptCG33655-RB
Protein status:BS32351.pep: gold
Sequenced Size:356

Clone Sequence Records

BS32351.complete Sequence

356 bp assembled on 2013-05-22

> BS32351.complete
GAAGTTATCAGTCGACATGTCCATCGTCCTTGATGTTATCCAACAAGTTG
TGTTGCAGAAAGCTTACGATCTAACATGCGAGGCAGCCATTTTAGCCTTG
AGAAAATGTGGCAAACTGAAAATAGAGGATGGTAAATCGAAAGCAAAGCG
TGAAAAGCCTCTACCTCCGGTCAAGCCTATTTCCCAGGAAGCGGTTTCAC
CAATGAAAGCTCCAACGATTCCCGAGGCTAACACCATTCCAAAATATACG
GGACGGGACATGCCTCGAAAGAACTTTGGCTCCATCGATCCCCCCCAATG
CTCCTGCATGCGTGTGTGCCGAGATAGTTACTTCTCTTAGAAGCTTTCTA
GACCAT

BS32351.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 13:42:29
Subject Length Description Subject Range Query Range Score Percent Strand
CG33655-RB 324 CG33655-PB 1..324 17..340 1620 100 Plus
CG33655-RC 123 CG33655-PC 1..123 17..135 520 96.7 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 13:42:30
Subject Length Description Subject Range Query Range Score Percent Strand
CG33655-RB 2164 CR33655-RB 55..379 17..341 1625 100 Plus
CG33655-RC 2168 CG33655-RC 55..383 17..341 1550 98.8 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 13:42:27
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 21319578..21319803 341..116 1130 100 Minus
2R 25286936 2R 21319861..21319963 119..17 500 99 Minus
Blast to na_te.dros performed on 2014-11-28 13:42:28 has no hits.

BS32351.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2013-05-22 10:00:53 Download gff for BS32351.complete
Subject Subject Range Query Range Percent Splice Strand
CG33655-RB 55..378 17..340 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 23:12:48 Download gff for BS32351.complete
Subject Subject Range Query Range Percent Splice Strand
CG33655-RB 55..378 17..340 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 14:33:15 Download gff for BS32351.complete
Subject Subject Range Query Range Percent Splice Strand
CG33655-RB 55..378 17..340 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 14:33:15 Download gff for BS32351.complete
Subject Subject Range Query Range Percent Splice Strand
2R 21319579..21319803 116..340 100 <- Minus
2R 21319865..21319963 17..115 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 23:12:48 Download gff for BS32351.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 17207084..17207308 116..340 100 <- Minus
arm_2R 17207370..17207468 17..115 100   Minus

BS32351.pep Sequence

Translation from 16 to 339

> BS32351.pep
MSIVLDVIQQVVLQKAYDLTCEAAILALRKCGKLKIEDGKSKAKREKPLP
PVKPISQEAVSPMKAPTIPEANTIPKYTGRDMPRKNFGSIDPPQCSCMRV
CRDSYFS*

BS32351.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:19:10
Subject Length Description Subject Range Query Range Score Percent Strand
CG33655-PB 107 CR33655-PB 1..107 1..107 559 100 Plus
CG33655-PC 40 CG33655-PC 1..34 1..34 162 97.1 Plus