Clone BS32352 Report

Search the DGRC for BS32352

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:323
Well:52
Vector:pDNR-Dual
Associated Gene/TranscriptCG32811-RB
Protein status:BS32352.pep: gold
Sequenced Size:266

Clone Sequence Records

BS32352.complete Sequence

266 bp assembled on 2013-05-22

> BS32352.complete
GAAGTTATCAGTCGACATGGACCTCATTGTGCCACCGAACGGACTCTATG
AGATGCCACACCAACCAGAGTATCCGGATTATGAGGCGATGAGAAGACCG
GTAGAGTCGTTGCGCATGGTGAAGCAGAAGGAAGTTCTGGTCGATAGGGA
ACTCGAGTTTTTCTTCAATACGGAAGATATAACGAAAGTCAATTCCGAGG
TGTTTCGAGGTGTGACTAGTGGTCACAGCACAGAATTTGGGACTCGTTAG
AAGCTTTCTAGACCAT

BS32352.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 13:42:25
Subject Length Description Subject Range Query Range Score Percent Strand
CG32811-RB 234 CG32811-PB 1..234 17..250 1170 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 13:42:26
Subject Length Description Subject Range Query Range Score Percent Strand
CG32811-RB 404 CG32811-RB 56..290 16..250 1175 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 13:42:23
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 1298098..1298332 250..16 1175 100 Minus
Blast to na_te.dros performed 2014-11-28 13:42:24
Subject Length Description Subject Range Query Range Score Percent Strand
Fw2 3961 Fw2 FW2 3961bp 587..628 177..137 99 73.8 Minus

BS32352.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.32.fasta performed 2013-05-22 10:00:51 Download gff for BS32352.complete
Subject Subject Range Query Range Percent Splice Strand
CG32811-RB 57..290 17..250 100   Plus
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-08-04 23:12:45 Download gff for BS32352.complete
Subject Subject Range Query Range Percent Splice Strand
CG32811-RB 57..290 17..250 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 14:33:13 Download gff for BS32352.complete
Subject Subject Range Query Range Percent Splice Strand
CG32811-RB 57..290 17..250 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 14:33:13 Download gff for BS32352.complete
Subject Subject Range Query Range Percent Splice Strand
X 1298098..1298331 17..250 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-08-04 23:12:45 Download gff for BS32352.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 1192131..1192364 17..250 100   Minus

BS32352.pep Sequence

Translation from 16 to 249

> BS32352.pep
MDLIVPPNGLYEMPHQPEYPDYEAMRRPVESLRMVKQKEVLVDRELEFFF
NTEDITKVNSEVFRGVTSGHSTEFGTR*

BS32352.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:19:09
Subject Length Description Subject Range Query Range Score Percent Strand
CG32811-PB 77 CG32811-PB 1..77 1..77 405 100 Plus