BS32501.complete Sequence
320 bp assembled on 2013-09-16
GenBank Submission: KX805823
> BS32501.complete
GAAGTTATCAGTCGACATGAAGTTCTTCATCGCCGCCTTCCTGATCGCCG
CCTGCATGGCCCTCGCCCAGTGCAGTGTCATCTACTCGCCGGTGTCCTCC
GTTCCGGTGGTCCGTTCCGTGCCCGTTATTCGCTCCGTTCCGGTGGTGCG
CAGTGTGCCTGTGGTCCGCCGTGTGCCGGTGGTTCGCCGTGTCAATGTGG
TCGAGTCCGTTCCAGTGGTGCCCTCGGTGGTGCGCGTTGGACAGGCCCCC
ATCTACGATGCTCCACTGGTGCAGTCCTATGGTGGATGGTTGAAGCAGAA
GTAGAAGCTTTCTAGACCAT
BS32501.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 13:55:39
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG15308-RB | 288 | CG15308-PB | 1..288 | 17..304 | 1440 | 100 | Plus |
CG15308-RC | 249 | CG15308-PC | 1..249 | 56..304 | 1245 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 13:55:40
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG15308-RB | 532 | CG15308-RB | 60..350 | 15..305 | 1455 | 100 | Plus |
CG15308-RC | 494 | CG15308-RC | 118..405 | 18..305 | 1425 | 99.7 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 13:55:37
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
X | 23542271 | X | 10218095..10218379 | 305..21 | 1425 | 100 | Minus |
Blast to na_te.dros performed on 2014-11-28 13:55:38 has no hits.
BS32501.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-09-16 12:01:56 Download gff for
BS32501.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG15308-RB | 62..349 | 17..304 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 14:37:41 Download gff for
BS32501.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG15308-RB | 62..349 | 17..304 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 14:37:41 Download gff for
BS32501.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
X | 10218096..10218382 | 17..304 | 99 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-09-16 12:01:56 Download gff for
BS32501.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_X | 10112129..10112415 | 17..304 | 99 | | Minus |
BS32501.pep Sequence
Translation from 16 to 303
> BS32501.pep
MKFFIAAFLIAACMALAQCSVIYSPVSSVPVVRSVPVIRSVPVVRSVPVV
RRVPVVRRVNVVESVPVVPSVVRVGQAPIYDAPLVQSYGGWLKQK*
BS32501.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:43:37
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG15308-PB | 95 | CG15308-PB | 1..95 | 1..95 | 470 | 100 | Plus |
CG15308-PC | 82 | CG15308-PC | 1..82 | 14..95 | 405 | 100 | Plus |
CG34268-PA | 83 | CG34268-PA | 5..70 | 5..70 | 140 | 48.5 | Plus |