BS32504.complete Sequence
305 bp assembled on 2013-09-16
GenBank Submission: KX806355
> BS32504.complete
GAAGTTATCAGTCGACATGGCAAAGTTATTTTCCATCCTTTTGTGCCTGG
CTATTATCGGATTCATCAGCGCAGCTCCTATAGAGGACAAGAAACCCGCT
GAGGAGGCTGATCTCTCCACCGCGGACTCCATTGGCTACGGCTACTATGC
AGCTCCATCGCCAATTTACTACGGCGGCTATGGAGGTGGCTACAAGTACG
GCGGATATTCCGGTTACGGCGGCTACGGCGGATATCGCTCCTACGGAGGC
GGATTCTATCGTCCCCGAATTTACCCAGTTTGGGGATAAAAGCTTTCTAG
ACCAT
BS32504.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 13:55:54
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG13177-RB | 273 | CG13177-PB | 1..273 | 17..289 | 1365 | 100 | Plus |
CG13177-RA | 273 | CG13177-PA | 1..273 | 17..289 | 1365 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 13:55:55
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG13177-RB | 1099 | CG13177-RB | 118..390 | 17..289 | 1365 | 100 | Plus |
CG13177-RA | 639 | CG13177-RA | 118..390 | 17..289 | 1365 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 13:55:52
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25286936 | 2R | 12163982..12164187 | 84..289 | 1030 | 100 | Plus |
2R | 25286936 | 2R | 12163860..12163922 | 24..86 | 315 | 100 | Plus |
Blast to na_te.dros performed on 2014-11-28 13:55:53 has no hits.
BS32504.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-09-16 12:02:02 Download gff for
BS32504.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13177-RA | 118..388 | 17..287 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 14:37:48 Download gff for
BS32504.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG13177-RA | 118..388 | 17..287 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 14:37:48 Download gff for
BS32504.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 12163860..12163921 | 24..85 | 100 | -> | Plus |
2R | 12163984..12164185 | 86..287 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-09-16 12:02:02 Download gff for
BS32504.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2R | 8051365..8051426 | 24..85 | 100 | -> | Plus |
arm_2R | 8051489..8051690 | 86..287 | 100 | | Plus |
BS32504.pep Sequence
Translation from 16 to 288
> BS32504.pep
MAKLFSILLCLAIIGFISAAPIEDKKPAEEADLSTADSIGYGYYAAPSPI
YYGGYGGGYKYGGYSGYGGYGGYRSYGGGFYRPRIYPVWG*
BS32504.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:43:41
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG13177-PB | 90 | CG13177-PB | 1..90 | 1..90 | 497 | 100 | Plus |
CG13177-PA | 90 | CG13177-PA | 1..90 | 1..90 | 497 | 100 | Plus |
CG9269-PA | 146 | CG9269-PA | 31..96 | 23..87 | 133 | 47.1 | Plus |