Clone BS32504 Report

Search the DGRC for BS32504

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:325
Well:4
Vector:pDNR-Dual
Associated Gene/TranscriptCG13177-RA
Protein status:BS32504.pep: full length peptide match
Sequenced Size:305

Clone Sequence Records

BS32504.complete Sequence

305 bp assembled on 2013-09-16

GenBank Submission: KX806355

> BS32504.complete
GAAGTTATCAGTCGACATGGCAAAGTTATTTTCCATCCTTTTGTGCCTGG
CTATTATCGGATTCATCAGCGCAGCTCCTATAGAGGACAAGAAACCCGCT
GAGGAGGCTGATCTCTCCACCGCGGACTCCATTGGCTACGGCTACTATGC
AGCTCCATCGCCAATTTACTACGGCGGCTATGGAGGTGGCTACAAGTACG
GCGGATATTCCGGTTACGGCGGCTACGGCGGATATCGCTCCTACGGAGGC
GGATTCTATCGTCCCCGAATTTACCCAGTTTGGGGATAAAAGCTTTCTAG
ACCAT

BS32504.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 13:55:54
Subject Length Description Subject Range Query Range Score Percent Strand
CG13177-RB 273 CG13177-PB 1..273 17..289 1365 100 Plus
CG13177-RA 273 CG13177-PA 1..273 17..289 1365 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 13:55:55
Subject Length Description Subject Range Query Range Score Percent Strand
CG13177-RB 1099 CG13177-RB 118..390 17..289 1365 100 Plus
CG13177-RA 639 CG13177-RA 118..390 17..289 1365 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 13:55:52
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 12163982..12164187 84..289 1030 100 Plus
2R 25286936 2R 12163860..12163922 24..86 315 100 Plus
Blast to na_te.dros performed on 2014-11-28 13:55:53 has no hits.

BS32504.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-09-16 12:02:02 Download gff for BS32504.complete
Subject Subject Range Query Range Percent Splice Strand
CG13177-RA 118..388 17..287 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 14:37:48 Download gff for BS32504.complete
Subject Subject Range Query Range Percent Splice Strand
CG13177-RA 118..388 17..287 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 14:37:48 Download gff for BS32504.complete
Subject Subject Range Query Range Percent Splice Strand
2R 12163860..12163921 24..85 100 -> Plus
2R 12163984..12164185 86..287 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-09-16 12:02:02 Download gff for BS32504.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 8051365..8051426 24..85 100 -> Plus
arm_2R 8051489..8051690 86..287 100   Plus

BS32504.pep Sequence

Translation from 16 to 288

> BS32504.pep
MAKLFSILLCLAIIGFISAAPIEDKKPAEEADLSTADSIGYGYYAAPSPI
YYGGYGGGYKYGGYSGYGGYGGYRSYGGGFYRPRIYPVWG*

BS32504.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:43:41
Subject Length Description Subject Range Query Range Score Percent Strand
CG13177-PB 90 CG13177-PB 1..90 1..90 497 100 Plus
CG13177-PA 90 CG13177-PA 1..90 1..90 497 100 Plus
CG9269-PA 146 CG9269-PA 31..96 23..87 133 47.1 Plus