Clone BS32505 Report

Search the DGRC for BS32505

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:325
Well:5
Vector:pDNR-Dual
Associated Gene/TranscriptCG34194-RA
Protein status:BS32505.pep: full length peptide match
Sequenced Size:347

Clone Sequence Records

BS32505.complete Sequence

347 bp assembled on 2013-09-16

GenBank Submission: KX805776

> BS32505.complete
GAAGTTATCAGTCGACATGTCGCAAAGCATGTTCCCAAAGCTGGCCGAGG
ATTACGCGAAATTCAAGCGCTATGTGAAATGGCTGTACACCCTCTACGAA
CTGAACACACAGATCGCCATATGTGAGCCGTGGGAAAAGGTCTTCCTCAA
TGTCCTCCTCGGCAGCTTCGTCTCCCTGATCCTCTACGCATCCTTTGCCT
TTGTGCCGGGCTATTGTGTCACCGTCTTCCAGCTTTTATGGCCCCAAACG
AGCGTGCAAAATCTCACCAGCGTTTGCAGTACGAGTACGGAGGGCTTTTG
CGGCAACGAAAGCGGATCAGTAATAACATAAAAACTTTCTAGACCAT

BS32505.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 13:55:58
Subject Length Description Subject Range Query Range Score Percent Strand
CG34194-RB 315 CG34194-PB 1..315 17..331 1575 100 Plus
CG34194-RA 315 CG34194-PA 1..315 17..331 1575 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 13:55:59
Subject Length Description Subject Range Query Range Score Percent Strand
CG34194-RB 655 CG34194-RB 298..613 16..331 1580 100 Plus
CG34194-RA 413 CG34194-RA 56..371 16..331 1580 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 13:55:56
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 17544822..17545003 150..331 910 100 Plus
2R 25286936 2R 17544487..17544620 16..149 670 100 Plus
Blast to na_te.dros performed on 2014-11-28 13:55:57 has no hits.

BS32505.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-09-16 12:02:03 Download gff for BS32505.complete
Subject Subject Range Query Range Percent Splice Strand
CG34194-RA 57..369 17..329 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 14:37:50 Download gff for BS32505.complete
Subject Subject Range Query Range Percent Splice Strand
CG34194-RA 57..369 17..329 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 14:37:50 Download gff for BS32505.complete
Subject Subject Range Query Range Percent Splice Strand
2R 17544488..17544620 17..149 100 -> Plus
2R 17544822..17545001 150..329 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-09-16 12:02:03 Download gff for BS32505.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 13431993..13432125 17..149 100 -> Plus
arm_2R 13432327..13432506 150..329 100   Plus

BS32505.pep Sequence

Translation from 16 to 330

> BS32505.pep
MSQSMFPKLAEDYAKFKRYVKWLYTLYELNTQIAICEPWEKVFLNVLLGS
FVSLILYASFAFVPGYCVTVFQLLWPQTSVQNLTSVCSTSTEGFCGNESG
SVIT*

BS32505.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:43:42
Subject Length Description Subject Range Query Range Score Percent Strand
CG34194-PB 104 CG34194-PB 1..104 1..104 550 100 Plus
CG34194-PA 104 CG34194-PA 1..104 1..104 550 100 Plus