BS32519.complete Sequence
266 bp assembled on 2013-09-16
GenBank Submission: KX802074
> BS32519.complete
GAAGTTATCAGTCGACATGCAGAAGCCACATCATGGTCCGTGCTGGATGT
TGCTTCTACTGGCATCGCTGATCGGTACTTTTATGCTGGCCTTCAGCTAC
TGGATGTTTGTGCCGCGCGAGGAGTCACTATGGTCAATGATATCGAACTA
CAGTGGATCTGGAATAAAGTACTCCCTGCCGCCGTCAGCAGTACCTGAGG
AACTTAAGCTTCGGCAGAGACCGCCCTTCGTTTACCAGATATTACATTGA
AAGCTTTCTAGACCAT
BS32519.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 13:56:42
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| CG42489-RB | 234 | CG42489-PB | 1..234 | 17..250 | 1170 | 100 | Plus |
| CG42489-RC | 234 | CG42489-PC | 1..234 | 17..250 | 1170 | 100 | Plus |
| CG42489-RA | 234 | CG42489-PA | 1..234 | 17..250 | 1170 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 13:56:43
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| CG42489-RB | 511 | CG42489-RB | 204..440 | 17..253 | 1185 | 100 | Plus |
| CG42489-RC | 373 | CG42489-RC | 66..302 | 17..253 | 1185 | 100 | Plus |
| CG42489-RA | 442 | CG42489-RA | 135..371 | 17..253 | 1185 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 13:56:40
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| 3R | 32079331 | 3R | 8653873..8654109 | 253..17 | 1185 | 100 | Minus |
Blast to na_te.dros performed on 2014-11-28 13:56:41 has no hits.
BS32519.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-09-16 12:02:20 Download gff for
BS32519.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG42489-RA | 135..367 | 17..249 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 14:38:05 Download gff for
BS32519.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| CG42489-RA | 135..367 | 17..249 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 14:38:05 Download gff for
BS32519.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| 3R | 8653877..8654109 | 17..249 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-09-16 12:02:20 Download gff for
BS32519.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| arm_3R | 4479599..4479831 | 17..249 | 100 | | Minus |
BS32519.pep Sequence
Translation from 16 to 249
> BS32519.pep
MQKPHHGPCWMLLLLASLIGTFMLAFSYWMFVPREESLWSMISNYSGSGI
KYSLPPSAVPEELKLRQRPPFVYQILH*
BS32519.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:44:03
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| CG42489-PB | 77 | CG42489-PB | 1..77 | 1..77 | 419 | 100 | Plus |
| CG42489-PC | 77 | CG42489-PC | 1..77 | 1..77 | 419 | 100 | Plus |
| CG42489-PA | 77 | CG42489-PA | 1..77 | 1..77 | 419 | 100 | Plus |
