Clone BS32548 Report

Search the DGRC for BS32548

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:325
Well:48
Vector:pDNR-Dual
Associated Gene/TranscriptNplp4-RA
Protein status:BS32548.pep: full length peptide match
Sequenced Size:227

Clone Sequence Records

BS32548.complete Sequence

227 bp assembled on 2013-09-16

GenBank Submission: KX802020

> BS32548.complete
GAAGTTATCAGTCGACATGTTCAAGCTGCTGGTTGTCGTTTTCGCTGCCC
TCTTCGCCGCTGCTCTGGCTGTTCCCGCTCCAGTTGCCCGTGCCAATCCC
GCCCCAATCCCGATTGCCAGCCCCGAGCCCGCCCCCCAGTACTACTACGG
AGCTAGCCCATACGCCTACTCCGGAGGATACTACGATTCGCCCTACTCCT
ACTACGGCTAAAAGCTTTCTAGACCAT

BS32548.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 13:57:30
Subject Length Description Subject Range Query Range Score Percent Strand
Nplp4-RB 195 CG15361-PB 1..195 17..211 975 100 Plus
Nplp4-RA 195 CG15361-PA 1..195 17..211 975 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 13:57:31
Subject Length Description Subject Range Query Range Score Percent Strand
Nplp4-RB 528 CG15361-RB 115..311 15..211 985 100 Plus
Nplp4-RA 380 CG15361-RA 73..269 15..211 985 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 13:57:28
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 2008672..2008855 28..211 920 100 Plus
Blast to na_te.dros performed on 2014-11-28 13:57:29 has no hits.

BS32548.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-09-16 12:02:39 Download gff for BS32548.complete
Subject Subject Range Query Range Percent Splice Strand
Nplp4-RA 80..267 22..209 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 14:38:19 Download gff for BS32548.complete
Subject Subject Range Query Range Percent Splice Strand
Nplp4-RA 80..267 22..209 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 14:38:19 Download gff for BS32548.complete
Subject Subject Range Query Range Percent Splice Strand
2L 2008668..2008853 22..209 97   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-09-16 12:02:39 Download gff for BS32548.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 2008668..2008853 22..209 97   Plus

BS32548.pep Sequence

Translation from 16 to 210

> BS32548.pep
MFKLLVVVFAALFAAALAVPAPVARANPAPIPIASPEPAPQYYYGASPYA
YSGGYYDSPYSYYG*

BS32548.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:44:18
Subject Length Description Subject Range Query Range Score Percent Strand
Nplp4-PB 64 CG15361-PB 1..64 1..64 339 100 Plus
Nplp4-PA 64 CG15361-PA 1..64 1..64 339 100 Plus