BS32548.complete Sequence
227 bp assembled on 2013-09-16
GenBank Submission: KX802020
> BS32548.complete
GAAGTTATCAGTCGACATGTTCAAGCTGCTGGTTGTCGTTTTCGCTGCCC
TCTTCGCCGCTGCTCTGGCTGTTCCCGCTCCAGTTGCCCGTGCCAATCCC
GCCCCAATCCCGATTGCCAGCCCCGAGCCCGCCCCCCAGTACTACTACGG
AGCTAGCCCATACGCCTACTCCGGAGGATACTACGATTCGCCCTACTCCT
ACTACGGCTAAAAGCTTTCTAGACCAT
BS32548.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 13:57:30
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Nplp4-RB | 195 | CG15361-PB | 1..195 | 17..211 | 975 | 100 | Plus |
Nplp4-RA | 195 | CG15361-PA | 1..195 | 17..211 | 975 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 13:57:31
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Nplp4-RB | 528 | CG15361-RB | 115..311 | 15..211 | 985 | 100 | Plus |
Nplp4-RA | 380 | CG15361-RA | 73..269 | 15..211 | 985 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 13:57:28
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 2008672..2008855 | 28..211 | 920 | 100 | Plus |
Blast to na_te.dros performed on 2014-11-28 13:57:29 has no hits.
BS32548.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-09-16 12:02:39 Download gff for
BS32548.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Nplp4-RA | 80..267 | 22..209 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 14:38:19 Download gff for
BS32548.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Nplp4-RA | 80..267 | 22..209 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 14:38:19 Download gff for
BS32548.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 2008668..2008853 | 22..209 | 97 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-09-16 12:02:39 Download gff for
BS32548.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2L | 2008668..2008853 | 22..209 | 97 | | Plus |
BS32548.pep Sequence
Translation from 16 to 210
> BS32548.pep
MFKLLVVVFAALFAAALAVPAPVARANPAPIPIASPEPAPQYYYGASPYA
YSGGYYDSPYSYYG*
BS32548.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:44:18
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Nplp4-PB | 64 | CG15361-PB | 1..64 | 1..64 | 339 | 100 | Plus |
Nplp4-PA | 64 | CG15361-PA | 1..64 | 1..64 | 339 | 100 | Plus |