Clone BS32549 Report

Search the DGRC for BS32549

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:325
Well:49
Vector:pDNR-Dual
Associated Gene/TranscriptCG14752-RA
Protein status:BS32549.pep: full length peptide match
Sequenced Size:371

Clone Sequence Records

BS32549.complete Sequence

371 bp assembled on 2013-09-16

GenBank Submission: KX802922

> BS32549.complete
GAAGTTATCAGTCGACATGTCCGTCCTGAAAGTATTCATCTTCGTCGCCC
TCTTCGCCGTGGCCTACTGCGCACCCAGTCCCGGCTTCTTTGGCAAACAC
GAGCACCACACCATCCACGTGCCCTACAAGGTGCACACGGTGCACCACCA
TCACGTTCAGAAGGTCCATGTGCCGGTGGTGAAGCACGTGCCGGTGCCCA
TTTACAAGGAGGTGCCCGTGCACCACGTCCACCACGAGGAGATCCCCGTG
CCGGTGCACCACGTCCATCACGAGGAGATCCCGGTGCACCATGTCTTCGA
TGACCACCACGACCACCACGGCTGGAGCTCCCACCACGGACACGGCTGGC
TGTAAAAGCTTTCTAGACCAT

BS32549.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 13:58:13
Subject Length Description Subject Range Query Range Score Percent Strand
CG14752-RA 339 CG14752-PA 1..339 17..355 1695 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 13:58:14
Subject Length Description Subject Range Query Range Score Percent Strand
CG14752-RA 540 CG14752-RA 73..412 16..355 1700 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 13:58:12
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 8591565..8591820 100..355 1280 100 Plus
2R 25286936 2R 8591023..8591084 38..99 310 100 Plus
Blast to na_te.dros performed 2014-11-28 13:58:12
Subject Length Description Subject Range Query Range Score Percent Strand
invader2 5124 invader2 INVADER2 5124bp 719..753 71..37 121 82.9 Minus

BS32549.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-09-16 12:02:57 Download gff for BS32549.complete
Subject Subject Range Query Range Percent Splice Strand
CG14752-RA 74..410 17..353 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 14:38:37 Download gff for BS32549.complete
Subject Subject Range Query Range Percent Splice Strand
CG14752-RA 74..410 17..353 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 14:38:37 Download gff for BS32549.complete
Subject Subject Range Query Range Percent Splice Strand
2R 8591565..8591818 100..353 100   Plus
2R 8590570..8590590 17..37 100 -> Plus
2R 8591023..8591084 38..99 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-09-16 12:02:57 Download gff for BS32549.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 4478075..4478095 17..37 100 -> Plus
arm_2R 4478528..4478589 38..99 100 -> Plus
arm_2R 4479070..4479323 100..353 100   Plus

BS32549.pep Sequence

Translation from 16 to 354

> BS32549.pep
MSVLKVFIFVALFAVAYCAPSPGFFGKHEHHTIHVPYKVHTVHHHHVQKV
HVPVVKHVPVPIYKEVPVHHVHHEEIPVPVHHVHHEEIPVHHVFDDHHDH
HGWSSHHGHGWL*

BS32549.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:44:34
Subject Length Description Subject Range Query Range Score Percent Strand
CG14752-PA 112 CG14752-PA 1..112 1..112 662 100 Plus
CG14052-PB 163 CG14052-PB 7..114 3..107 150 36.3 Plus
CG13482-PA 102 CG13482-PA 22..97 26..109 140 40 Plus