Clone BS32557 Report

Search the DGRC for BS32557

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:325
Well:57
Vector:pDNR-Dual
Associated Gene/TranscriptCG13998-RA
Protein status:BS32557.pep: gold
Sequenced Size:326

Clone Sequence Records

BS32557.complete Sequence

326 bp assembled on 2013-09-16

GenBank Submission: KX806514

> BS32557.complete
GAAGTTATCAGTCGACATGGCTAAGACGATGACGTTCTGGTTTCTGGTCT
TGGCTCTGGTGACCTTAAATCCAACCTGGCCATTCTGGCGCACAGGGGCT
GCCGAAGTCACTTCCGCATCGATGTTCCAGTTTCTGGACCGCCACAATGG
TGAAGGCGACCACAGTTGGTCTCACCTACTGCCCACAAACTTCTACTCCG
AGATGAACCAGCAGTACTACAGGAGATTCCGGCGACAGGCTGGCAGAATG
GACACCTTCCGATCGGGAAAACGGCAGCAGTACCCTTTTGAATATGCTCG
ATATGTCTGAAAGCTTTCTAGACCAT

BS32557.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 13:58:47
Subject Length Description Subject Range Query Range Score Percent Strand
CG13998-RA 294 CG13998-PA 1..294 17..310 1470 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 13:58:48
Subject Length Description Subject Range Query Range Score Percent Strand
CG13998-RA 331 CG13998-RA 15..308 17..310 1470 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 13:58:44
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 5956512..5956805 310..17 1470 100 Minus
Blast to na_te.dros performed on 2014-11-28 13:58:45 has no hits.

BS32557.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-09-16 12:03:11 Download gff for BS32557.complete
Subject Subject Range Query Range Percent Splice Strand
CG13998-RA 15..307 17..309 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 14:38:50 Download gff for BS32557.complete
Subject Subject Range Query Range Percent Splice Strand
CG13998-RA 15..307 17..309 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 14:38:50 Download gff for BS32557.complete
Subject Subject Range Query Range Percent Splice Strand
2L 5956513..5956805 17..309 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-09-16 12:03:11 Download gff for BS32557.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 5956513..5956805 17..309 100   Minus

BS32557.pep Sequence

Translation from 16 to 309

> BS32557.pep
MAKTMTFWFLVLALVTLNPTWPFWRTGAAEVTSASMFQFLDRHNGEGDHS
WSHLLPTNFYSEMNQQYYRRFRRQAGRMDTFRSGKRQQYPFEYARYV*

BS32557.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:44:49
Subject Length Description Subject Range Query Range Score Percent Strand
CG13998-PA 97 CG13998-PA 1..97 1..97 535 100 Plus