Clone BS32558 Report

Search the DGRC for BS32558

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:325
Well:58
Vector:pDNR-Dual
Associated Gene/TranscriptCG34212-RA
Protein status:BS32558.pep: gold
Sequenced Size:179

Clone Sequence Records

BS32558.complete Sequence

179 bp assembled on 2013-09-16

GenBank Submission: KX801067

> BS32558.complete
GAAGTTATCAGTCGACATGATTGCCACAACGGTGTGTTTCTACTTGGTGG
TCTTGGCCATTCTCATGGCCTTCCTGTCTCCCACAGCAGATGGTTGCTTC
ATCCTGCTTGCGTGCCTGTTGAAGTCACCCCTCTGTCCGTTCAACACCAC
ATCATCTGGATGAAAGCTTTCTAGACCAT

BS32558.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 13:57:59
Subject Length Description Subject Range Query Range Score Percent Strand
CG34212-RA 147 CG34212-PA 1..147 17..163 735 100 Plus
CG34212-RB 147 CG34212-PB 1..147 17..163 735 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 13:58:01
Subject Length Description Subject Range Query Range Score Percent Strand
CG34212-RA 274 CG34212-RA 26..172 17..163 735 100 Plus
CG34212-RB 358 CG34212-RB 110..256 17..163 735 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 13:57:57
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 6049976..6050122 163..17 735 100 Minus
Blast to na_te.dros performed on 2014-11-28 13:57:58 has no hits.

BS32558.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-09-16 12:02:53 Download gff for BS32558.complete
Subject Subject Range Query Range Percent Splice Strand
CG34212-RB 110..255 17..162 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 14:38:30 Download gff for BS32558.complete
Subject Subject Range Query Range Percent Splice Strand
CG34212-RB 110..255 17..162 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 14:38:30 Download gff for BS32558.complete
Subject Subject Range Query Range Percent Splice Strand
2R 6049977..6050122 17..162 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-09-16 12:02:53 Download gff for BS32558.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 1937482..1937627 17..162 100   Minus

BS32558.pep Sequence

Translation from 16 to 162

> BS32558.pep
MIATTVCFYLVVLAILMAFLSPTADGCFILLACLLKSPLCPFNTTSSG*

BS32558.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:44:29
Subject Length Description Subject Range Query Range Score Percent Strand
CG34212-PA 48 CG34212-PA 1..48 1..48 248 100 Plus
CG34212-PB 48 CG34212-PB 1..48 1..48 248 100 Plus