BS32558.complete Sequence
179 bp assembled on 2013-09-16
GenBank Submission: KX801067
> BS32558.complete
GAAGTTATCAGTCGACATGATTGCCACAACGGTGTGTTTCTACTTGGTGG
TCTTGGCCATTCTCATGGCCTTCCTGTCTCCCACAGCAGATGGTTGCTTC
ATCCTGCTTGCGTGCCTGTTGAAGTCACCCCTCTGTCCGTTCAACACCAC
ATCATCTGGATGAAAGCTTTCTAGACCAT
BS32558.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 13:57:59
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34212-RA | 147 | CG34212-PA | 1..147 | 17..163 | 735 | 100 | Plus |
CG34212-RB | 147 | CG34212-PB | 1..147 | 17..163 | 735 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 13:58:01
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34212-RA | 274 | CG34212-RA | 26..172 | 17..163 | 735 | 100 | Plus |
CG34212-RB | 358 | CG34212-RB | 110..256 | 17..163 | 735 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 13:57:57
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25286936 | 2R | 6049976..6050122 | 163..17 | 735 | 100 | Minus |
Blast to na_te.dros performed on 2014-11-28 13:57:58 has no hits.
BS32558.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-09-16 12:02:53 Download gff for
BS32558.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34212-RB | 110..255 | 17..162 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 14:38:30 Download gff for
BS32558.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG34212-RB | 110..255 | 17..162 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 14:38:30 Download gff for
BS32558.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 6049977..6050122 | 17..162 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-09-16 12:02:53 Download gff for
BS32558.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2R | 1937482..1937627 | 17..162 | 100 | | Minus |
BS32558.pep Sequence
Translation from 16 to 162
> BS32558.pep
MIATTVCFYLVVLAILMAFLSPTADGCFILLACLLKSPLCPFNTTSSG*
BS32558.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:44:29
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG34212-PA | 48 | CG34212-PA | 1..48 | 1..48 | 248 | 100 | Plus |
CG34212-PB | 48 | CG34212-PB | 1..48 | 1..48 | 248 | 100 | Plus |