BS32561.complete Sequence
185 bp assembled on 2013-09-16
GenBank Submission: KX800820
> BS32561.complete
GAAGTTATCAGTCGACATGCATTGTTATATTCCTATTGCGTTTTGCTTGT
TCGCTCTTTTGGAATTAACAAACGGGGTGAACGAAAAGGAAAGTTCTACC
TATTGTGTATCCTATTTTAATGGTGTATGCTGGGATAAAAGATTTAATAT
GTGGCCCACGGGAAAGTAGAAGCTTTCTAGACCAT
BS32561.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 13:59:03
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Sfp33A4-RA | 153 | CG42604-PA | 1..153 | 17..169 | 765 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 13:59:04
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Sfp33A4-RA | 244 | CG42604-RA | 17..170 | 17..170 | 770 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 13:59:00
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 11837259..11837412 | 17..170 | 770 | 100 | Plus |
Blast to na_te.dros performed on 2014-11-28 13:59:01 has no hits.
BS32561.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-09-16 12:03:17 Download gff for
BS32561.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Sfp33A4-RA | 17..169 | 17..169 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 14:38:54 Download gff for
BS32561.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Sfp33A4-RA | 17..169 | 17..169 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 14:38:54 Download gff for
BS32561.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 11837259..11837411 | 17..169 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-09-16 12:03:17 Download gff for
BS32561.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2L | 11837259..11837411 | 17..169 | 100 | | Plus |
BS32561.pep Sequence
Translation from 16 to 168
> BS32561.pep
MHCYIPIAFCLFALLELTNGVNEKESSTYCVSYFNGVCWDKRFNMWPTGK
*
BS32561.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:44:53
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Sfp33A4-PA | 50 | CG42604-PA | 1..50 | 1..50 | 289 | 100 | Plus |
Sfp33A2-PA | 50 | CG42473-PA | 1..50 | 1..50 | 138 | 48 | Plus |