Clone BS32561 Report

Search the DGRC for BS32561

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:325
Well:61
Vector:pDNR-Dual
Associated Gene/TranscriptSfp33A4-RA
Protein status:BS32561.pep: gold
Sequenced Size:185

Clone Sequence Records

BS32561.complete Sequence

185 bp assembled on 2013-09-16

GenBank Submission: KX800820

> BS32561.complete
GAAGTTATCAGTCGACATGCATTGTTATATTCCTATTGCGTTTTGCTTGT
TCGCTCTTTTGGAATTAACAAACGGGGTGAACGAAAAGGAAAGTTCTACC
TATTGTGTATCCTATTTTAATGGTGTATGCTGGGATAAAAGATTTAATAT
GTGGCCCACGGGAAAGTAGAAGCTTTCTAGACCAT

BS32561.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 13:59:03
Subject Length Description Subject Range Query Range Score Percent Strand
Sfp33A4-RA 153 CG42604-PA 1..153 17..169 765 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 13:59:04
Subject Length Description Subject Range Query Range Score Percent Strand
Sfp33A4-RA 244 CG42604-RA 17..170 17..170 770 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 13:59:00
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 11837259..11837412 17..170 770 100 Plus
Blast to na_te.dros performed on 2014-11-28 13:59:01 has no hits.

BS32561.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-09-16 12:03:17 Download gff for BS32561.complete
Subject Subject Range Query Range Percent Splice Strand
Sfp33A4-RA 17..169 17..169 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 14:38:54 Download gff for BS32561.complete
Subject Subject Range Query Range Percent Splice Strand
Sfp33A4-RA 17..169 17..169 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 14:38:54 Download gff for BS32561.complete
Subject Subject Range Query Range Percent Splice Strand
2L 11837259..11837411 17..169 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-09-16 12:03:17 Download gff for BS32561.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 11837259..11837411 17..169 100   Plus

BS32561.pep Sequence

Translation from 16 to 168

> BS32561.pep
MHCYIPIAFCLFALLELTNGVNEKESSTYCVSYFNGVCWDKRFNMWPTGK
*

BS32561.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:44:53
Subject Length Description Subject Range Query Range Score Percent Strand
Sfp33A4-PA 50 CG42604-PA 1..50 1..50 289 100 Plus
Sfp33A2-PA 50 CG42473-PA 1..50 1..50 138 48 Plus