Clone BS32562 Report

Search the DGRC for BS32562

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:325
Well:62
Vector:pDNR-Dual
Associated Gene/TranscriptCG42833-RA
Protein status:BS32562.pep: gold
Sequenced Size:296

Clone Sequence Records

BS32562.complete Sequence

296 bp assembled on 2013-09-16

GenBank Submission: KX805975

> BS32562.complete
GAAGTTATCAGTCGACATGCGAGCATCCAGAGGAAATGGATTTTCATTTT
ACTTGATCTTTTCATTGCTGCTAATCTGCAAATTGGAAAGGATCTTAGGT
GATGTAAGCCCGGCAGATGAGAAATCGATAGAGTCAAATATCGTCACAAT
TTGGGATCGAATTGCAAGCGGAGTTATAAACTATCCCTGGAAAACTAATA
TCATTGAGAAGGAGAGCCCAGAAACTACTAAGAGGAGATCGGTTCTATGG
CAAAGACTAACGATGGCCACAGTTCTTTAAAAGCTTTCTAGACCAT

BS32562.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 13:59:08
Subject Length Description Subject Range Query Range Score Percent Strand
CG42833-RA 264 CG42833-PA 1..264 17..280 1320 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 13:59:09
Subject Length Description Subject Range Query Range Score Percent Strand
CG42833-RA 395 CG42833-RA 26..289 17..280 1320 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 13:59:05
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 20200118..20200381 17..280 1320 100 Plus
Blast to na_te.dros performed on 2014-11-28 13:59:07 has no hits.

BS32562.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-09-16 12:03:18 Download gff for BS32562.complete
Subject Subject Range Query Range Percent Splice Strand
CG42833-RA 26..287 17..278 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 14:38:56 Download gff for BS32562.complete
Subject Subject Range Query Range Percent Splice Strand
CG42833-RA 26..287 17..278 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 14:38:56 Download gff for BS32562.complete
Subject Subject Range Query Range Percent Splice Strand
3L 20200118..20200379 17..278 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-09-16 12:03:18 Download gff for BS32562.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 20193218..20193479 17..278 100   Plus

BS32562.pep Sequence

Translation from 16 to 279

> BS32562.pep
MRASRGNGFSFYLIFSLLLICKLERILGDVSPADEKSIESNIVTIWDRIA
SGVINYPWKTNIIEKESPETTKRRSVLWQRLTMATVL*

BS32562.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:44:54
Subject Length Description Subject Range Query Range Score Percent Strand
CG42833-PA 87 CG42833-PA 1..87 1..87 444 100 Plus