Clone BS32566 Report

Search the DGRC for BS32566

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:325
Well:66
Vector:pDNR-Dual
Associated Gene/TranscriptCG42705-RA
Protein status:BS32566.pep: gold
Sequenced Size:296

Clone Sequence Records

BS32566.complete Sequence

296 bp assembled on 2013-09-16

GenBank Submission: KX803537

> BS32566.complete
GAAGTTATCAGTCGACATGAAGATTTCCCTAGCCGTTCTTGGCCTCTTTT
TGGCTTTCTTCTTCAGTTCACAAACGCCAACATCAGCTTTTTTCCTTCCA
CCGCCATCGGATATTTTCTGCAAATATTACCCTAATTATATTTTTTGTGG
CAAAAATGATAATGACACTGGATCGGGAAACTCGACTTCACCTGCAACAC
CTGGAAATTCAACCAGCAATGGAACTACTCCAGCAGAAGGAGGCCAACCC
CGTTCTTTGACACCACCATTTGGTTATTAAAAGCTTTCTAGACCAT

BS32566.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 13:59:29
Subject Length Description Subject Range Query Range Score Percent Strand
CG42705-RA 264 CG42705-PA 1..264 17..280 1320 100 Plus
CG42705-RB 264 CG42705-PB 1..264 17..280 1320 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 13:59:30
Subject Length Description Subject Range Query Range Score Percent Strand
CG42705-RA 391 CG42705-RA 24..287 17..280 1320 100 Plus
CG42705-RB 740 CG42705-RB 24..287 17..280 1320 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 13:59:27
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 7414018..7414209 89..280 960 100 Plus
X 23542271 X 7413892..7413963 17..88 360 100 Plus
Blast to na_te.dros performed 2014-11-28 13:59:28
Subject Length Description Subject Range Query Range Score Percent Strand
looper1 1881 looper1 LOOPER1_DM 1881bp 138..172 145..111 103 77.1 Minus
17.6 7439 17.6 DMIS176 7439bp AKA(J01060,J01061) Derived from X01472 (g8142) (Rel. 36, Last updated, Version 2). 1723..1761 144..107 102 76.9 Minus

BS32566.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-09-16 12:03:26 Download gff for BS32566.complete
Subject Subject Range Query Range Percent Splice Strand
CG42705-RA 24..285 17..278 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 14:39:03 Download gff for BS32566.complete
Subject Subject Range Query Range Percent Splice Strand
CG42705-RB 24..285 17..278 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 14:39:03 Download gff for BS32566.complete
Subject Subject Range Query Range Percent Splice Strand
X 7413892..7413963 17..88 100 -> Plus
X 7414018..7414207 89..278 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-09-16 12:03:26 Download gff for BS32566.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 7307925..7307996 17..88 100 -> Plus
arm_X 7308051..7308240 89..278 100   Plus

BS32566.pep Sequence

Translation from 16 to 279

> BS32566.pep
MKISLAVLGLFLAFFFSSQTPTSAFFLPPPSDIFCKYYPNYIFCGKNDND
TGSGNSTSPATPGNSTSNGTTPAEGGQPRSLTPPFGY*

BS32566.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:45:00
Subject Length Description Subject Range Query Range Score Percent Strand
CG42705-PA 87 CG42705-PA 1..87 1..87 474 100 Plus
CG42705-PB 87 CG42705-PB 1..87 1..87 474 100 Plus