Clone BS32571 Report

Search the DGRC for BS32571

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:325
Well:71
Vector:pDNR-Dual
Associated Gene/TranscriptCG9669-RA
Protein status:BS32571.pep: full length peptide match
Sequenced Size:269

Clone Sequence Records

BS32571.complete Sequence

269 bp assembled on 2013-09-16

GenBank Submission: KX803082

> BS32571.complete
GAAGTTATCAGTCGACATGGACGTAATGCAGCGCTACGTATCGCCCGTGA
ACCCGGCCGTTTTTCCCCACCTCGCCACCGTGCTTTTGGTCATCGGAACC
TTCTTCACCGCCTGGTTCTTCATCTTTGTGGTGTCTCGAAAGAGCTCTAA
GGAAAGCACCTTGATAAAGGAACTGCTGATTAGCCTGTGCGCCTCCATTT
TCCTGGGATTCGGCATTGTTTTCCTGCTTCTAACCGTCGGTATTTACGTA
TGAAAGCTTTCTAGACCAT

BS32571.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 13:58:52
Subject Length Description Subject Range Query Range Score Percent Strand
CG9669-RB 237 CG9669-PB 1..237 17..253 1185 100 Plus
CG9669-RA 237 CG9669-PA 1..237 17..253 1185 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 13:58:53
Subject Length Description Subject Range Query Range Score Percent Strand
CG9669-RB 345 CG9669-RB 52..288 17..253 1185 100 Plus
CG9669-RA 367 CG9669-RA 74..310 17..253 1185 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 13:58:49
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 16844625..16844861 253..17 1185 100 Minus
Blast to na_te.dros performed on 2014-11-28 13:58:50 has no hits.

BS32571.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-09-16 12:03:13 Download gff for BS32571.complete
Subject Subject Range Query Range Percent Splice Strand
CG9669-RA 74..309 17..252 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 14:38:52 Download gff for BS32571.complete
Subject Subject Range Query Range Percent Splice Strand
CG9669-RA 74..309 17..252 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 14:38:52 Download gff for BS32571.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16844626..16844861 17..252 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-09-16 12:03:13 Download gff for BS32571.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 16837726..16837961 17..252 100   Minus

BS32571.pep Sequence

Translation from 16 to 252

> BS32571.pep
MDVMQRYVSPVNPAVFPHLATVLLVIGTFFTAWFFIFVVSRKSSKESTLI
KELLISLCASIFLGFGIVFLLLTVGIYV*

BS32571.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:44:50
Subject Length Description Subject Range Query Range Score Percent Strand
CG9669-PB 78 CG9669-PB 1..78 1..78 388 100 Plus
CG9669-PA 78 CG9669-PA 1..78 1..78 388 100 Plus