Clone BS32577 Report

Search the DGRC for BS32577

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:325
Well:77
Vector:pDNR-Dual
Associated Gene/TranscriptCG15657-RA
Protein status:BS32577.pep: gold
Sequenced Size:374

Clone Sequence Records

BS32577.complete Sequence

374 bp assembled on 2013-09-16

GenBank Submission: KX802779

> BS32577.complete
GAAGTTATCAGTCGACATGCTGATCTACTATATTTATAGTGTGCTCGAAG
CCATTTCGTATGCGATCTACACAACAGTGGCCACCATTTCGAGCATTGAA
CAGGCCCTAATCAACCTGATGATGTCCACATTTCTGTTTGTGCTTGGGAT
AGCGTGTCACCCGGTAATGGTGATTCCCCTGATGCTGGGAGGCTACTATA
TTCTACGCAACTGTTTGAATCGTCGGACCAAGGCGCCAAGGCTGCAGAGT
TCCGTGGATGGCGATGCCGGACTGATCACGGCAGGACCACGTAAAGTGCC
ACGTTTTCCCTCTCATCGCAGCCTCGCTCTCGGCGTTGACGCTCCCAAGG
ACAACTAAAAGCTTTCTAGACCAT

BS32577.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 14:00:03
Subject Length Description Subject Range Query Range Score Percent Strand
CG15657-RB 342 CG15657-PB 1..342 17..358 1695 99.7 Plus
CG15657-RA 342 CG15657-PA 1..342 17..358 1695 99.7 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 14:00:04
Subject Length Description Subject Range Query Range Score Percent Strand
CG15657-RB 475 CG15657-RB 40..383 17..360 1705 99.7 Plus
CG15657-RA 617 CG15657-RA 40..383 17..360 1705 99.7 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 14:00:01
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 21147712..21147970 360..102 1295 100 Minus
2R 25286936 2R 21148030..21148114 101..17 410 98.8 Minus
Blast to na_te.dros performed on 2014-11-28 14:00:02 has no hits.

BS32577.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-09-16 12:03:38 Download gff for BS32577.complete
Subject Subject Range Query Range Percent Splice Strand
CG15657-RA 40..379 17..356 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 14:39:14 Download gff for BS32577.complete
Subject Subject Range Query Range Percent Splice Strand
CG15657-RA 40..379 17..356 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 14:39:14 Download gff for BS32577.complete
Subject Subject Range Query Range Percent Splice Strand
2R 21147716..21147970 102..356 100 <- Minus
2R 21148030..21148114 17..101 98   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-09-16 12:03:38 Download gff for BS32577.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 17035221..17035475 102..356 100 <- Minus
arm_2R 17035535..17035619 17..101 98   Minus

BS32577.pep Sequence

Translation from 16 to 357

> BS32577.pep
MLIYYIYSVLEAISYAIYTTVATISSIEQALINLMMSTFLFVLGIACHPV
MVIPLMLGGYYILRNCLNRRTKAPRLQSSVDGDAGLITAGPRKVPRFPSH
RSLALGVDAPKDN*

BS32577.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:45:10
Subject Length Description Subject Range Query Range Score Percent Strand
CG15657-PB 113 CG15657-PB 1..113 1..113 573 100 Plus
CG15657-PA 113 CG15657-PA 1..113 1..113 573 100 Plus