Clone BS32583 Report

Search the DGRC for BS32583

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:325
Well:83
Vector:pDNR-Dual
Associated Gene/TranscriptCG42869-RB
Protein status:BS32583.pep: gold
Sequenced Size:233

Clone Sequence Records

BS32583.complete Sequence

233 bp assembled on 2013-09-16

GenBank Submission: KX806074

> BS32583.complete
GAAGTTATCAGTCGACATGTTGATAGCCCGACTGGCGTTTTTAGTCTCTA
TTCTGGGCATTGTGGTTGGGTTCCAGAAACTGGACTCCACTTCCAGTCCC
ACGACTACCAGCACTATGAGGTCTGCCCCTTATTGTCAGCCAAGTGGAGG
ATATTGTCGGATGCATATGGATTGCTGTTCGCGAATGTGCATTCAAGTGT
CAGCAGAGTGTCGCTAGAAGCTTTCTAGACCAT

BS32583.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 13:59:38
Subject Length Description Subject Range Query Range Score Percent Strand
CG42869-RB 201 CG42869-PB 1..201 17..217 1005 100 Plus
CG43618-RA 171 CG43618-PA 34..171 80..217 585 94.9 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 13:59:39
Subject Length Description Subject Range Query Range Score Percent Strand
CG42869-RB 283 CG42869-RB 26..228 17..219 1015 100 Plus
CG43618-RA 225 CG43618-RA 43..182 80..219 595 95 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 13:59:35
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 21736687..21736824 154..17 690 100 Minus
3R 32079331 3R 21736568..21736636 219..151 330 98.6 Minus
3R 32079331 3R 8049209..8049283 80..154 315 94.7 Plus
3R 32079331 3R 8049345..8049413 151..219 285 94.2 Plus
Blast to na_te.dros performed on 2014-11-28 13:59:36 has no hits.

BS32583.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-09-16 12:03:30 Download gff for BS32583.complete
Subject Subject Range Query Range Percent Splice Strand
CG42869-RB 31..226 22..217 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 14:39:08 Download gff for BS32583.complete
Subject Subject Range Query Range Percent Splice Strand
CG42869-RB 31..226 22..217 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 14:39:08 Download gff for BS32583.complete
Subject Subject Range Query Range Percent Splice Strand
3R 21736570..21736632 155..217 100 <- Minus
3R 21736687..21736819 22..154 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-09-16 12:03:30 Download gff for BS32583.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 17562292..17562354 155..217 100 <- Minus
arm_3R 17562409..17562541 22..154 100   Minus

BS32583.pep Sequence

Translation from 16 to 216

> BS32583.pep
MLIARLAFLVSILGIVVGFQKLDSTSSPTTTSTMRSAPYCQPSGGYCRMH
MDCCSRMCIQVSAECR*

BS32583.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:45:03
Subject Length Description Subject Range Query Range Score Percent Strand
CG42869-PB 66 CG42869-PB 1..66 1..66 349 100 Plus
CG43618-PA 56 CG43618-PA 2..56 9..66 253 81 Plus