Clone BS32594 Report

Search the DGRC for BS32594

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:325
Well:94
Vector:pDNR-Dual
Associated Gene/TranscriptmRpL34-RA
Protein status:BS32594.pep: gold
Sequenced Size:278

Clone Sequence Records

BS32594.complete Sequence

278 bp assembled on 2013-09-16

GenBank Submission: KX805946

> BS32594.complete
GAAGTTATCAGTCGACATGCTGCAAGGAATGCTCCAAAGGACCTGCCTGG
CGGTTGTCAGCACCGCACAAACTCTAATCGTGCGGGATAAGCACGCTTTC
AACCGGGCGGTGCTGAAACCGAAAGTACGCTGCCATTTTCCGAAACCCAT
GGAGGTGAAGAGAATTAATGTCCACGGCTGGAATGCTAGGATGTCGACGC
CTGAGGGACGACGAGTGCTGATGAACCGGATCCTCAAAGGACGTCACAAT
TTGTCACACTAGAAGCTTTCTAGACCAT

BS32594.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 14:00:16
Subject Length Description Subject Range Query Range Score Percent Strand
mRpL34-RA 246 CG34147-PA 1..246 17..262 1230 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 14:00:17
Subject Length Description Subject Range Query Range Score Percent Strand
mRpL34-RA 327 CG34147-RA 44..291 15..262 1240 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 14:00:14
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 16099077..16099301 38..262 1125 100 Plus
Blast to na_te.dros performed on 2014-11-28 14:00:15 has no hits.

BS32594.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-09-16 12:03:44 Download gff for BS32594.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL34-RA 46..291 17..262 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 14:39:19 Download gff for BS32594.complete
Subject Subject Range Query Range Percent Splice Strand
mRpL34-RA 46..291 17..262 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 14:39:19 Download gff for BS32594.complete
Subject Subject Range Query Range Percent Splice Strand
2R 16098993..16099015 17..39 100 -> Plus
2R 16099079..16099301 40..262 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2013-09-16 12:03:44 Download gff for BS32594.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 11986498..11986520 17..39 100 -> Plus
arm_2R 11986584..11986806 40..262 100   Plus

BS32594.pep Sequence

Translation from 16 to 261

> BS32594.pep
MLQGMLQRTCLAVVSTAQTLIVRDKHAFNRAVLKPKVRCHFPKPMEVKRI
NVHGWNARMSTPEGRRVLMNRILKGRHNLSH*

BS32594.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:45:15
Subject Length Description Subject Range Query Range Score Percent Strand
mRpL34-PA 81 CG34147-PA 1..81 1..81 427 100 Plus