BS32594.complete Sequence
278 bp assembled on 2013-09-16
GenBank Submission: KX805946
> BS32594.complete
GAAGTTATCAGTCGACATGCTGCAAGGAATGCTCCAAAGGACCTGCCTGG
CGGTTGTCAGCACCGCACAAACTCTAATCGTGCGGGATAAGCACGCTTTC
AACCGGGCGGTGCTGAAACCGAAAGTACGCTGCCATTTTCCGAAACCCAT
GGAGGTGAAGAGAATTAATGTCCACGGCTGGAATGCTAGGATGTCGACGC
CTGAGGGACGACGAGTGCTGATGAACCGGATCCTCAAAGGACGTCACAAT
TTGTCACACTAGAAGCTTTCTAGACCAT
BS32594.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 14:00:16
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
mRpL34-RA | 246 | CG34147-PA | 1..246 | 17..262 | 1230 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 14:00:17
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
mRpL34-RA | 327 | CG34147-RA | 44..291 | 15..262 | 1240 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 14:00:14
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2R | 25286936 | 2R | 16099077..16099301 | 38..262 | 1125 | 100 | Plus |
Blast to na_te.dros performed on 2014-11-28 14:00:15 has no hits.
BS32594.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.52.fasta performed 2013-09-16 12:03:44 Download gff for
BS32594.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
mRpL34-RA | 46..291 | 17..262 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 14:39:19 Download gff for
BS32594.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
mRpL34-RA | 46..291 | 17..262 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 14:39:19 Download gff for
BS32594.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2R | 16098993..16099015 | 17..39 | 100 | -> | Plus |
2R | 16099079..16099301 | 40..262 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2013-09-16 12:03:44 Download gff for
BS32594.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2R | 11986498..11986520 | 17..39 | 100 | -> | Plus |
arm_2R | 11986584..11986806 | 40..262 | 100 | | Plus |
BS32594.pep Sequence
Translation from 16 to 261
> BS32594.pep
MLQGMLQRTCLAVVSTAQTLIVRDKHAFNRAVLKPKVRCHFPKPMEVKRI
NVHGWNARMSTPEGRRVLMNRILKGRHNLSH*
BS32594.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:45:15
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
mRpL34-PA | 81 | CG34147-PA | 1..81 | 1..81 | 427 | 100 | Plus |