Clone BS32719 Report

Search the DGRC for BS32719

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:327
Well:19
Vector:pDNR-Dual
Associated Gene/TranscriptCG43208-RA
Protein status:BS32719.pep: gold
Sequenced Size:254

Clone Sequence Records

BS32719.complete Sequence

254 bp assembled on 2014-01-22

GenBank Submission: KX801255

> BS32719.complete
GAAGTTATCAGTCGACATGGGACACATGCAGGACAGGATTAAGGACTTGA
TCACCGCTGAGCGCGTGGCTATATTCTTTGGTCTATTATCGACCTGCTTG
ATCGTTGCCCTTGTCATTGTGGCCGTCCACAGGGATAATTTATTGCTGCA
GTTGGACGAAGCCAAAAGGATGTTGGATGTTCTGGAGGAATACATTCAAA
GCCACTTGTTGTCCACCATTTCGGAAAGAAATTCATAAAAGCTTTCTAGA
CCAT

BS32719.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 14:43:52
Subject Length Description Subject Range Query Range Score Percent Strand
CG43208-RA 222 CG43208-PA 1..222 17..238 1110 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 14:43:53
Subject Length Description Subject Range Query Range Score Percent Strand
CG43208-RA 366 CG43208-RA 40..261 17..238 1110 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 14:43:50
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 13303557..13303751 44..238 975 100 Plus
Blast to na_te.dros performed on 2014-11-28 14:43:50 has no hits.

BS32719.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.52.fasta performed 2014-01-22 12:51:20 Download gff for BS32719.complete
Subject Subject Range Query Range Percent Splice Strand
CG43208-RA 40..259 17..236 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 15:21:18 Download gff for BS32719.complete
Subject Subject Range Query Range Percent Splice Strand
CG43208-RA 40..259 17..236 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 15:21:18 Download gff for BS32719.complete
Subject Subject Range Query Range Percent Splice Strand
3R 13303465..13303492 17..44 100 -> Plus
3R 13303558..13303749 45..236 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2014-01-22 12:51:20 Download gff for BS32719.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 9129187..9129214 17..44 100 -> Plus
arm_3R 9129280..9129471 45..236 100   Plus

BS32719.pep Sequence

Translation from 16 to 237

> BS32719.pep
MGHMQDRIKDLITAERVAIFFGLLSTCLIVALVIVAVHRDNLLLQLDEAK
RMLDVLEEYIQSHLLSTISERNS*

BS32719.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:50:18
Subject Length Description Subject Range Query Range Score Percent Strand
CG43208-PA 73 CG43208-PA 1..73 1..73 355 100 Plus