BS32719.complete Sequence
254 bp assembled on 2014-01-22
GenBank Submission: KX801255
> BS32719.complete
GAAGTTATCAGTCGACATGGGACACATGCAGGACAGGATTAAGGACTTGA
TCACCGCTGAGCGCGTGGCTATATTCTTTGGTCTATTATCGACCTGCTTG
ATCGTTGCCCTTGTCATTGTGGCCGTCCACAGGGATAATTTATTGCTGCA
GTTGGACGAAGCCAAAAGGATGTTGGATGTTCTGGAGGAATACATTCAAA
GCCACTTGTTGTCCACCATTTCGGAAAGAAATTCATAAAAGCTTTCTAGA
CCAT
BS32719.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 14:43:52
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG43208-RA | 222 | CG43208-PA | 1..222 | 17..238 | 1110 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 14:43:53
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG43208-RA | 366 | CG43208-RA | 40..261 | 17..238 | 1110 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 14:43:50
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 32079331 | 3R | 13303557..13303751 | 44..238 | 975 | 100 | Plus |
Blast to na_te.dros performed on 2014-11-28 14:43:50 has no hits.
BS32719.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.52.fasta performed 2014-01-22 12:51:20 Download gff for
BS32719.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG43208-RA | 40..259 | 17..236 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 15:21:18 Download gff for
BS32719.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG43208-RA | 40..259 | 17..236 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 15:21:18 Download gff for
BS32719.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 13303465..13303492 | 17..44 | 100 | -> | Plus |
3R | 13303558..13303749 | 45..236 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2014-01-22 12:51:20 Download gff for
BS32719.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3R | 9129187..9129214 | 17..44 | 100 | -> | Plus |
arm_3R | 9129280..9129471 | 45..236 | 100 | | Plus |
BS32719.pep Sequence
Translation from 16 to 237
> BS32719.pep
MGHMQDRIKDLITAERVAIFFGLLSTCLIVALVIVAVHRDNLLLQLDEAK
RMLDVLEEYIQSHLLSTISERNS*
BS32719.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:50:18
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG43208-PA | 73 | CG43208-PA | 1..73 | 1..73 | 355 | 100 | Plus |