BS32727.complete Sequence
266 bp assembled on 2014-01-22
GenBank Submission: KX802733
> BS32727.complete
GAAGTTATCAGTCGACATGCTTAGTAATCCCTACTTTAAGTCCGTTTTGT
GGCTGATTGGCTTCGGAGGAATGGGGTACGGCCTAATGGTGTTAACCGAG
CCGAACGTCGACAAGTTAGAGCGCATCAAAGCCTCCGTTTCAAGTACCAA
ACTGAGTGCGGATGAGCAGCGAAAGGCTCTGTTTATGAAGAAGCTCCAGG
AGGCGTCCACCACCAGTGCCCCAATCTACAGGTCATCGTCCGAGAAATAG
AAGCTTTCTAGACCAT
BS32727.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 14:44:23
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG15386-RA | 234 | CG15386-PA | 1..234 | 17..250 | 1170 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 14:44:24
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG42371-RA | 691 | CG42371-RA | 386..619 | 17..250 | 1170 | 100 | Plus |
CG15386-RA | 691 | CG15386-RA | 386..619 | 17..250 | 1170 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 14:44:21
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 2216575..2216808 | 250..17 | 1170 | 100 | Minus |
Blast to na_te.dros performed on 2014-11-28 14:44:22 has no hits.
BS32727.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.52.fasta performed 2014-01-22 12:51:28 Download gff for
BS32727.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG15386-RA | 386..613 | 17..244 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 15:21:33 Download gff for
BS32727.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG15386-RA | 386..613 | 17..244 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 15:21:33 Download gff for
BS32727.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 2216581..2216808 | 17..244 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2014-01-22 12:51:28 Download gff for
BS32727.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2L | 2216581..2216808 | 17..244 | 100 | | Minus |
BS32727.pep Sequence
Translation from 16 to 249
> BS32727.pep
MLSNPYFKSVLWLIGFGGMGYGLMVLTEPNVDKLERIKASVSSTKLSADE
QRKALFMKKLQEASTTSAPIYRSSSEK*
BS32727.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:50:29
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG15386-PA | 77 | CG15386-PA | 1..77 | 1..77 | 383 | 100 | Plus |