Clone BS32727 Report

Search the DGRC for BS32727

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:327
Well:27
Vector:pDNR-Dual
Associated Gene/TranscriptCG15386-RA
Protein status:BS32727.pep: full length peptide match
Sequenced Size:266

Clone Sequence Records

BS32727.complete Sequence

266 bp assembled on 2014-01-22

GenBank Submission: KX802733

> BS32727.complete
GAAGTTATCAGTCGACATGCTTAGTAATCCCTACTTTAAGTCCGTTTTGT
GGCTGATTGGCTTCGGAGGAATGGGGTACGGCCTAATGGTGTTAACCGAG
CCGAACGTCGACAAGTTAGAGCGCATCAAAGCCTCCGTTTCAAGTACCAA
ACTGAGTGCGGATGAGCAGCGAAAGGCTCTGTTTATGAAGAAGCTCCAGG
AGGCGTCCACCACCAGTGCCCCAATCTACAGGTCATCGTCCGAGAAATAG
AAGCTTTCTAGACCAT

BS32727.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 14:44:23
Subject Length Description Subject Range Query Range Score Percent Strand
CG15386-RA 234 CG15386-PA 1..234 17..250 1170 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 14:44:24
Subject Length Description Subject Range Query Range Score Percent Strand
CG42371-RA 691 CG42371-RA 386..619 17..250 1170 100 Plus
CG15386-RA 691 CG15386-RA 386..619 17..250 1170 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 14:44:21
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 2216575..2216808 250..17 1170 100 Minus
Blast to na_te.dros performed on 2014-11-28 14:44:22 has no hits.

BS32727.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.52.fasta performed 2014-01-22 12:51:28 Download gff for BS32727.complete
Subject Subject Range Query Range Percent Splice Strand
CG15386-RA 386..613 17..244 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 15:21:33 Download gff for BS32727.complete
Subject Subject Range Query Range Percent Splice Strand
CG15386-RA 386..613 17..244 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 15:21:33 Download gff for BS32727.complete
Subject Subject Range Query Range Percent Splice Strand
2L 2216581..2216808 17..244 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2014-01-22 12:51:28 Download gff for BS32727.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 2216581..2216808 17..244 100   Minus

BS32727.pep Sequence

Translation from 16 to 249

> BS32727.pep
MLSNPYFKSVLWLIGFGGMGYGLMVLTEPNVDKLERIKASVSSTKLSADE
QRKALFMKKLQEASTTSAPIYRSSSEK*

BS32727.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:50:29
Subject Length Description Subject Range Query Range Score Percent Strand
CG15386-PA 77 CG15386-PA 1..77 1..77 383 100 Plus