Clone BS32741 Report

Search the DGRC for BS32741

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:327
Well:41
Vector:pDNR-Dual
Associated Gene/TranscriptCG43450-RA
Protein status:BS32741.pep: full length peptide match
Sequenced Size:179

Clone Sequence Records

BS32741.complete Sequence

179 bp assembled on 2014-01-22

GenBank Submission: KX806469

> BS32741.complete
GAAGTTATCAGTCGACATGAATCTTAGGAGGACGCCCTGCCCCCAATTAA
ACACCACCGCAACCACAATGAAGAAATGTGTAATTGCCTGTTCGTCTTTC
GGTTCTCCGTCAACGTCGTGCTGCTCTCATTGGCCACGATTATTCTCATC
CTCCGCATGGTGAAAGCTTTCTAGACCAT

BS32741.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 14:44:51
Subject Length Description Subject Range Query Range Score Percent Strand
CG43450-RA 147 CG43450-PA 1..147 17..163 735 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 14:44:52
Subject Length Description Subject Range Query Range Score Percent Strand
CG43450-RA 281 CG43450-RA 48..194 17..163 735 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 14:44:50
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 12195341..12195487 17..163 735 100 Plus
Blast to na_te.dros performed on 2014-11-28 14:44:50 has no hits.

BS32741.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.52.fasta performed 2014-01-22 12:51:41 Download gff for BS32741.complete
Subject Subject Range Query Range Percent Splice Strand
CG43450-RA 48..193 17..162 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 15:21:44 Download gff for BS32741.complete
Subject Subject Range Query Range Percent Splice Strand
CG43450-RA 48..193 17..162 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 15:21:44 Download gff for BS32741.complete
Subject Subject Range Query Range Percent Splice Strand
3R 12195341..12195486 17..162 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2014-01-22 12:51:41 Download gff for BS32741.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 8021063..8021208 17..162 100   Plus

BS32741.pep Sequence

Translation from 16 to 162

> BS32741.pep
MNLRRTPCPQLNTTATTMKKCVIACSSFGSPSTSCCSHWPRLFSSSAW*

BS32741.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:50:46
Subject Length Description Subject Range Query Range Score Percent Strand
CG43450-PA 48 CG43450-PA 1..48 1..48 271 100 Plus