BS32741.complete Sequence
179 bp assembled on 2014-01-22
GenBank Submission: KX806469
> BS32741.complete
GAAGTTATCAGTCGACATGAATCTTAGGAGGACGCCCTGCCCCCAATTAA
ACACCACCGCAACCACAATGAAGAAATGTGTAATTGCCTGTTCGTCTTTC
GGTTCTCCGTCAACGTCGTGCTGCTCTCATTGGCCACGATTATTCTCATC
CTCCGCATGGTGAAAGCTTTCTAGACCAT
BS32741.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 14:44:51
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG43450-RA | 147 | CG43450-PA | 1..147 | 17..163 | 735 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 14:44:52
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG43450-RA | 281 | CG43450-RA | 48..194 | 17..163 | 735 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 14:44:50
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 32079331 | 3R | 12195341..12195487 | 17..163 | 735 | 100 | Plus |
Blast to na_te.dros performed on 2014-11-28 14:44:50 has no hits.
BS32741.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.52.fasta performed 2014-01-22 12:51:41 Download gff for
BS32741.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG43450-RA | 48..193 | 17..162 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 15:21:44 Download gff for
BS32741.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG43450-RA | 48..193 | 17..162 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 15:21:44 Download gff for
BS32741.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 12195341..12195486 | 17..162 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2014-01-22 12:51:41 Download gff for
BS32741.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3R | 8021063..8021208 | 17..162 | 100 | | Plus |
BS32741.pep Sequence
Translation from 16 to 162
> BS32741.pep
MNLRRTPCPQLNTTATTMKKCVIACSSFGSPSTSCCSHWPRLFSSSAW*
BS32741.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:50:46
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG43450-PA | 48 | CG43450-PA | 1..48 | 1..48 | 271 | 100 | Plus |