Clone BS32756 Report

Search the DGRC for BS32756

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:327
Well:56
Vector:pDNR-Dual
Associated Gene/TranscriptCG43733-RA
Protein status:BS32756.pep: full length peptide match
Sequenced Size:287

Clone Sequence Records

BS32756.complete Sequence

287 bp assembled on 2014-01-22

GenBank Submission: KX802752

> BS32756.complete
GAAGTTATCAGTCGACATGCAGCACTACAACAACAACTACTACTACTATT
ACAACTACAACTTGAGCTATGAGCCGCCGGTCGATCGGTCGCTGGGCGGC
GGGGGCAAGCGGAGCATTCAACGTCTGCAGCAACTGGTGCGAAGGACGCG
GTACGAGCTGCAGCAATGGCCGCTACTGATGCAGCTGCTCCTGTTCGTCC
TTTGGCTAAATGCCAAGTTCTGGCAGCTGGTCAACGAACAGGTGACCTAC
CGCCGCAGGAGGTGGCACTGAAAGCTTTCTAGACCAT

BS32756.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 14:45:29
Subject Length Description Subject Range Query Range Score Percent Strand
Ggamma30A-RJ 717 CG3694-PJ 463..717 17..271 1275 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 14:45:30
Subject Length Description Subject Range Query Range Score Percent Strand
Ggamma30A-RJ 2995 CG3694-RJ 1136..1390 17..271 1275 100 Plus
Ggamma30A-RI 849 CG3694-RI 456..710 17..271 1275 100 Plus
Ggamma30A-RH 4742 CG3694-RH 626..880 17..271 1275 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 14:45:28
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 9291405..9291659 17..271 1275 100 Plus
Blast to na_te.dros performed on 2014-11-28 14:45:29 has no hits.

BS32756.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.52.fasta performed 2014-01-22 12:51:57 Download gff for BS32756.complete
Subject Subject Range Query Range Percent Splice Strand
Ggamma30A-RH 626..879 17..270 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 15:22:06 Download gff for BS32756.complete
Subject Subject Range Query Range Percent Splice Strand
Ggamma30A-RH 626..879 17..270 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 15:22:06 Download gff for BS32756.complete
Subject Subject Range Query Range Percent Splice Strand
2L 9291405..9291658 17..270 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2014-01-22 12:51:57 Download gff for BS32756.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 9291405..9291658 17..270 100   Plus

BS32756.pep Sequence

Translation from 16 to 270

> BS32756.pep
MQHYNNNYYYYYNYNLSYEPPVDRSLGGGGKRSIQRLQQLVRRTRYELQQ
WPLLMQLLLFVLWLNAKFWQLVNEQVTYRRRRWH*

BS32756.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:51:06
Subject Length Description Subject Range Query Range Score Percent Strand
Ggamma30A-PJ 238 CG3694-PJ 155..238 1..84 467 100 Plus