BS32756.complete Sequence
287 bp assembled on 2014-01-22
GenBank Submission: KX802752
> BS32756.complete
GAAGTTATCAGTCGACATGCAGCACTACAACAACAACTACTACTACTATT
ACAACTACAACTTGAGCTATGAGCCGCCGGTCGATCGGTCGCTGGGCGGC
GGGGGCAAGCGGAGCATTCAACGTCTGCAGCAACTGGTGCGAAGGACGCG
GTACGAGCTGCAGCAATGGCCGCTACTGATGCAGCTGCTCCTGTTCGTCC
TTTGGCTAAATGCCAAGTTCTGGCAGCTGGTCAACGAACAGGTGACCTAC
CGCCGCAGGAGGTGGCACTGAAAGCTTTCTAGACCAT
BS32756.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 14:45:29
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Ggamma30A-RJ | 717 | CG3694-PJ | 463..717 | 17..271 | 1275 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 14:45:30
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Ggamma30A-RJ | 2995 | CG3694-RJ | 1136..1390 | 17..271 | 1275 | 100 | Plus |
Ggamma30A-RI | 849 | CG3694-RI | 456..710 | 17..271 | 1275 | 100 | Plus |
Ggamma30A-RH | 4742 | CG3694-RH | 626..880 | 17..271 | 1275 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 14:45:28
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 9291405..9291659 | 17..271 | 1275 | 100 | Plus |
Blast to na_te.dros performed on 2014-11-28 14:45:29 has no hits.
BS32756.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.52.fasta performed 2014-01-22 12:51:57 Download gff for
BS32756.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Ggamma30A-RH | 626..879 | 17..270 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 15:22:06 Download gff for
BS32756.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
Ggamma30A-RH | 626..879 | 17..270 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 15:22:06 Download gff for
BS32756.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 9291405..9291658 | 17..270 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2014-01-22 12:51:57 Download gff for
BS32756.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2L | 9291405..9291658 | 17..270 | 100 | | Plus |
BS32756.pep Sequence
Translation from 16 to 270
> BS32756.pep
MQHYNNNYYYYYNYNLSYEPPVDRSLGGGGKRSIQRLQQLVRRTRYELQQ
WPLLMQLLLFVLWLNAKFWQLVNEQVTYRRRRWH*
BS32756.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:51:06
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
Ggamma30A-PJ | 238 | CG3694-PJ | 155..238 | 1..84 | 467 | 100 | Plus |