BS32769.complete Sequence
263 bp assembled on 2014-01-22
GenBank Submission: KX804809
> BS32769.complete
GAAGTTATCAGTCGACATGTCCTCAGTGGAGGCCGAGGTGCTGCAGAAAA
TCGATCTGATTGAGCCCACAACCGGAAAATTGTTTTTCGAGCACAAAACG
GAGCTGCTTTTCTGCCGGCCACATCTGATGCCGCTAAAGACGCAGGCGCT
GGAACGCCTGGAGGAAATGCATCGGGACACCGCTCGCCAATTGCAGAAGA
AGCGCCAGCAGAAGAAGAAGTCCACGGAGCCCACAGGCTCGCTATGAAAG
CTTTCTAGACCAT
BS32769.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 14:45:52
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG42511-RA | 231 | CG42511-PA | 1..231 | 17..247 | 1155 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 14:45:53
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG42511-RA | 2767 | CG42511-RA | 163..394 | 17..248 | 1160 | 100 | Plus |
CG8135-RA | 2767 | CG8135-RA | 163..394 | 17..248 | 1160 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 14:45:51
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 32079331 | 3R | 9404547..9404778 | 17..248 | 1160 | 100 | Plus |
Blast to na_te.dros performed on 2014-11-28 14:45:51 has no hits.
BS32769.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.52.fasta performed 2014-01-22 12:52:07 Download gff for
BS32769.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG8135-RA | 163..392 | 17..246 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 15:22:17 Download gff for
BS32769.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG8135-RA | 163..392 | 17..246 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 15:22:17 Download gff for
BS32769.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 9404547..9404776 | 17..246 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2014-01-22 12:52:07 Download gff for
BS32769.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3R | 5230269..5230498 | 17..246 | 100 | | Plus |
BS32769.pep Sequence
Translation from 16 to 246
> BS32769.pep
MSSVEAEVLQKIDLIEPTTGKLFFEHKTELLFCRPHLMPLKTQALERLEE
MHRDTARQLQKKRQQKKKSTEPTGSL*
BS32769.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:51:16
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG42511-PA | 76 | CG42511-PA | 1..76 | 1..76 | 386 | 100 | Plus |