Clone BS32769 Report

Search the DGRC for BS32769

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:327
Well:69
Vector:pDNR-Dual
Associated Gene/TranscriptCG42511-RA
Protein status:BS32769.pep: full length peptide match
Sequenced Size:263

Clone Sequence Records

BS32769.complete Sequence

263 bp assembled on 2014-01-22

GenBank Submission: KX804809

> BS32769.complete
GAAGTTATCAGTCGACATGTCCTCAGTGGAGGCCGAGGTGCTGCAGAAAA
TCGATCTGATTGAGCCCACAACCGGAAAATTGTTTTTCGAGCACAAAACG
GAGCTGCTTTTCTGCCGGCCACATCTGATGCCGCTAAAGACGCAGGCGCT
GGAACGCCTGGAGGAAATGCATCGGGACACCGCTCGCCAATTGCAGAAGA
AGCGCCAGCAGAAGAAGAAGTCCACGGAGCCCACAGGCTCGCTATGAAAG
CTTTCTAGACCAT

BS32769.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 14:45:52
Subject Length Description Subject Range Query Range Score Percent Strand
CG42511-RA 231 CG42511-PA 1..231 17..247 1155 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 14:45:53
Subject Length Description Subject Range Query Range Score Percent Strand
CG42511-RA 2767 CG42511-RA 163..394 17..248 1160 100 Plus
CG8135-RA 2767 CG8135-RA 163..394 17..248 1160 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 14:45:51
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 9404547..9404778 17..248 1160 100 Plus
Blast to na_te.dros performed on 2014-11-28 14:45:51 has no hits.

BS32769.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.52.fasta performed 2014-01-22 12:52:07 Download gff for BS32769.complete
Subject Subject Range Query Range Percent Splice Strand
CG8135-RA 163..392 17..246 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 15:22:17 Download gff for BS32769.complete
Subject Subject Range Query Range Percent Splice Strand
CG8135-RA 163..392 17..246 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 15:22:17 Download gff for BS32769.complete
Subject Subject Range Query Range Percent Splice Strand
3R 9404547..9404776 17..246 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2014-01-22 12:52:07 Download gff for BS32769.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 5230269..5230498 17..246 100   Plus

BS32769.pep Sequence

Translation from 16 to 246

> BS32769.pep
MSSVEAEVLQKIDLIEPTTGKLFFEHKTELLFCRPHLMPLKTQALERLEE
MHRDTARQLQKKRQQKKKSTEPTGSL*

BS32769.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:51:16
Subject Length Description Subject Range Query Range Score Percent Strand
CG42511-PA 76 CG42511-PA 1..76 1..76 386 100 Plus