Clone BS32774 Report

Search the DGRC for BS32774

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:327
Well:74
Vector:pDNR-Dual
Associated Gene/TranscriptATPsyn-beta-RB
Protein status:BS32774.pep: full length peptide match
Sequenced Size:416

Clone Sequence Records

BS32774.complete Sequence

416 bp assembled on 2014-01-22

GenBank Submission: KX800788

> BS32774.complete
GAAGTTATCAGTCGACATGTTCGCGTTACGTGCTGCATCTAAAGCCGATA
AGAATTTGCTGCCATTCTTGGGGCAATTGTCTCGTAGCCATGCTGCCAAG
GCTGCAAAGGCTGCAGCTGCCGCAAATGGAAAGATTGTGGCCGTAATTGG
TGCAGTCGTCGATGTCCAGTTTGATGATAACTTACCGCCCATTCTGAATG
CCTTGGAAGTAGACAACCGTTCTCCTCGGCTCGTGCTAGAGGTGGCCCAG
CACTTGGGAGAAAATACCGTGCGCACTATCGCCATGGATGGTACCGAAGG
CTTGGTTCGCGGACAGAAGGTTCTCGATACTGGGTATCCTATCCGAATTC
CAGTTGGTGCCGAAACACTAGGACGCATCATTAATGTTATTGGTAAGTAA
AAGCTTTCTAGACCAT

BS32774.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 14:46:00
Subject Length Description Subject Range Query Range Score Percent Strand
ATPsyn-beta-RD 1518 CG11154-PD 1..378 17..394 1890 100 Plus
ATPsyn-beta-RA 1518 CG11154-PA 1..378 17..394 1890 100 Plus
ATPsyn-beta-RC 1536 CG11154-PC 1..396 17..394 1675 95.5 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 14:46:01
Subject Length Description Subject Range Query Range Score Percent Strand
ATPsyn-beta-RD 2048 CG11154-RD 27..404 17..394 1890 100 Plus
ATPsyn-beta-RA 1688 CG11154-RA 27..404 17..394 1890 100 Plus
ATPsyn-beta-RC 2026 CG11154-RC 347..742 17..394 1675 95.5 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 14:45:58
Subject Length Description Subject Range Query Range Score Percent Strand
4 1348131 4 1032907..1033227 81..401 1605 100 Plus
4 1348131 4 1031890..1031953 17..80 320 100 Plus
Blast to na_te.dros performed on 2014-11-28 14:45:59 has no hits.

BS32774.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.52.fasta performed 2014-01-22 12:52:12 Download gff for BS32774.complete
Subject Subject Range Query Range Percent Splice Strand
ATPsyn-beta-RB 32..408 22..398 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 15:22:21 Download gff for BS32774.complete
Subject Subject Range Query Range Percent Splice Strand
ATPsyn-beta-RA 32..405 22..398 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 15:22:21 Download gff for BS32774.complete
Subject Subject Range Query Range Percent Splice Strand
4 1031895..1031953 22..80 100 -> Plus
4 1032907..1033224 81..398 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2014-01-22 12:52:12 Download gff for BS32774.complete
Subject Subject Range Query Range Percent Splice Strand
arm_4 1052521..1052579 22..80 100 -> Plus
arm_4 1053533..1053850 81..398 100   Plus

BS32774.pep Sequence

Translation from 16 to 399

> BS32774.pep
MFALRAASKADKNLLPFLGQLSRSHAAKAAKAAAAANGKIVAVIGAVVDV
QFDDNLPPILNALEVDNRSPRLVLEVAQHLGENTVRTIAMDGTEGLVRGQ
KVLDTGYPIRIPVGAETLGRIINVIGK*

BS32774.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:51:19
Subject Length Description Subject Range Query Range Score Percent Strand
ATPsyn-beta-PD 505 CG11154-PD 1..127 1..127 620 99.2 Plus
ATPsyn-beta-PA 505 CG11154-PA 1..127 1..127 620 99.2 Plus
ATPsyn-beta-PC 511 CG11154-PC 1..133 1..127 603 94.7 Plus
ms(3)72Dt-PA 622 CG5389-PA 104..193 38..126 267 62.2 Plus