Clone BS32791 Report

Search the DGRC for BS32791

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:327
Well:91
Vector:pDNR-Dual
Associated Gene/TranscriptCG17691-RG
Protein status:BS32791.pep: full length peptide match
Sequenced Size:359

Clone Sequence Records

BS32791.complete Sequence

359 bp assembled on 2014-01-22

GenBank Submission: KX803027

> BS32791.complete
GAAGTTATCAGTCGACATGAACATCGTAAGCACTCAACTAGGGAATAGTT
TGTATAACTGCGTGCGATCTAATCTAAGATGGCCCTTGTGGACTCGATCA
CATTTTACCTACTATCCTACACGTATGGGAACTGGAAAACGAATGAATAT
GTTTAACGCCATTAATAACGCAATGGATTTGGCTCTAGACGAAAACAAAT
CCGCATTGTTGTTTGGCGAGGATGTGGGATTCGGTGGAGTTTTTCGGTGT
TCAGTAAATCTACGGGATAAGTACGGAAGTCAGCGTGTTTTTAATACCCC
CTTATGTGAGCAAGGAATCGCAGGGTACCCCGTGGACCGATAAAAGCTTT
CTAGACCAT

BS32791.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 14:46:35
Subject Length Description Subject Range Query Range Score Percent Strand
CG17691-RF 321 CG17691-PF 1..312 17..328 1560 100 Plus
CG17691-RE 1095 CG17691-PE 1..308 17..324 1540 100 Plus
CG17691-RC 1095 CG17691-PC 1..308 17..324 1540 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 14:46:36
Subject Length Description Subject Range Query Range Score Percent Strand
CG17691-RF 479 CG17691-RF 85..396 17..328 1560 100 Plus
CG17691-RE 1221 CG17691-RE 85..392 17..324 1540 100 Plus
CG17691-RC 1244 CG17691-RC 108..415 17..324 1540 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 14:46:33
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 1590654..1590885 17..248 1160 100 Plus
2R 25286936 2R 1590939..1591021 246..328 415 100 Plus
Blast to na_te.dros performed on 2014-11-28 14:46:34 has no hits.

BS32791.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.52.fasta performed 2014-01-22 12:52:26 Download gff for BS32791.complete
Subject Subject Range Query Range Percent Splice Strand
CG17691-RG 92..416 17..341 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 15:22:38 Download gff for BS32791.complete
Subject Subject Range Query Range Percent Splice Strand
CG17691-RF 85..398 17..333 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 15:22:38 Download gff for BS32791.complete
Subject Subject Range Query Range Percent Splice Strand
2R 1590654..1590883 17..246 100 -> Plus
2R 1590940..1591017 247..324 100 -> Plus
2R 1595766..1595782 325..341 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2014-01-22 12:52:26 Download gff for BS32791.complete
Subject Subject Range Query Range Percent Splice Strand
ArmU 1178971..1179200 17..246 100 -> Plus
ArmU 1179257..1179334 247..324 100 -> Plus
ArmU 1184083..1184099 325..341 100   Plus

BS32791.pep Sequence

Translation from 16 to 342

> BS32791.pep
MNIVSTQLGNSLYNCVRSNLRWPLWTRSHFTYYPTRMGTGKRMNMFNAIN
NAMDLALDENKSALLFGEDVGFGGVFRCSVNLRDKYGSQRVFNTPLCEQG
IAGYPVDR*

BS32791.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:51:38
Subject Length Description Subject Range Query Range Score Percent Strand
CG17691-PF 106 CG17691-PF 1..106 1..106 564 98.1 Plus
CG17691-PE 364 CG17691-PE 1..106 1..106 561 97.2 Plus
CG17691-PC 364 CG17691-PC 1..106 1..106 561 97.2 Plus