Clone BS32794 Report

Search the DGRC for BS32794

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:327
Well:94
Vector:pDNR-Dual
Associated Gene/TranscriptCG43173-RA
Protein status:BS32794.pep: full length peptide match
Sequenced Size:248

Clone Sequence Records

BS32794.complete Sequence

248 bp assembled on 2014-01-22

GenBank Submission: KX800297

> BS32794.complete
GAAGTTATCAGTCGACATGTATGTATGTATGTCCAATATATATGTCCAAG
AGTCGGGGCCAGTTCAACAAACCCCATTGAACTCAATCCGGAGCAATGAC
ACCTCGCCGGGCCCTACAATCCGCACTCAACCTCACTTTCTTTTACGTGC
ATATGTCCATCCCTGTCATCCAAACATCTCTCTCTCCCTCTTGCACCCTT
TGGCCGTTGAGGGGCTTACGGTTGTCTTATAGAAGCTTTCTAGACCAT

BS32794.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed on 2014-11-28 14:46:24 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed on 2014-11-28 14:46:25 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 14:46:23
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 17935172..17935388 17..233 1085 100 Plus
Blast to na_te.dros performed on 2014-11-28 14:46:23 has no hits.

BS32794.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.52.fasta performed 2014-01-22 12:52:22 Download gff for BS32794.complete
Subject Subject Range Query Range Percent Splice Strand
CG43173-RA 767..982 17..232 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 15:22:34 Download gff for BS32794.complete
Subject Subject Range Query Range Percent Splice Strand
3L 17935172..17935387 17..232 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 15:22:34 Download gff for BS32794.complete
Subject Subject Range Query Range Percent Splice Strand
3L 17935172..17935387 17..232 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2014-01-22 12:52:22 Download gff for BS32794.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 17928272..17928487 17..232 100   Plus

BS32794.pep Sequence

Translation from 16 to 231

> BS32794.pep
MYVCMSNIYVQESGPVQQTPLNSIRSNDTSPGPTIRTQPHFLLRAYVHPC
HPNISLSLLHPLAVEGLTVVL*
Sequence BS32794.pep has no blast hits.