Clone BS32942 Report

Search the DGRC for BS32942

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:329
Well:42
Vector:pDNR-Dual
Associated Gene/TranscriptCG14207-RC
Protein status:BS32942.pep: gold
Sequenced Size:497

Clone Sequence Records

BS32942.complete Sequence

497 bp assembled on 2014-01-22

GenBank Submission: KX806191

> BS32942.complete
GAAGTTATCAGTCGACATGGAGGCCTTTACGCGCACACTGCAAAATACCT
TTCGCAGCACTAGGACCACCAGAACCACTACTACAACAACCACAAACTCC
TCCACCAGCTCAACGACAAACTCGGCGCTGCCATCCCGAATCCCAAAGCA
ACAGAACTACGTCTCCGACATTAGCTCACCCTTGATCCAGGATGAGGGCG
ATAACAAAGTGCTGAAGCTGCGTTTCGATGTCAGCCAGTATGCGCCCGAG
GAAATTGTTGTGAAAACCGTCGACCAGAAGCTATTGGTGCACGCCAAGCA
CGAGGAGAAGTCGGACACAAAGAGCGTGTACAGGGAGTACAATCGGGAGT
TCCTGCTGCCCAAGGGCGTCAATCCCGAGTCCATCCGCTCGTCCCTCAGC
AAGGACGGAGTCCTGACCGTGGACGCCCCCCTGCCAGCACTCACCGCCGG
CGAGACACTGATTCCCATTGCGCACAAGTGAAAGCTTTCTAGACCAT

BS32942.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 14:48:36
Subject Length Description Subject Range Query Range Score Percent Strand
CG14207-RC 465 CG14207-PC 1..465 17..481 2325 100 Plus
CG14207-RD 552 CG14207-PD 172..552 101..481 1905 100 Plus
CG14207-RA 552 CG14207-PA 172..552 101..481 1905 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 14:48:37
Subject Length Description Subject Range Query Range Score Percent Strand
CG14207-RC 753 CG14207-RC 25..491 16..482 2335 100 Plus
CG14207-RD 1380 CG14207-RD 477..858 101..482 1910 100 Plus
CG14207-RA 1240 CG14207-RA 477..858 101..482 1910 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 14:48:35
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 19610695..19610891 286..482 985 100 Plus
X 23542271 X 19610525..19610625 188..288 505 100 Plus
X 23542271 X 19610162..19610254 16..108 465 100 Plus
X 23542271 X 19610378..19610463 106..191 430 100 Plus
Blast to na_te.dros performed on 2014-11-28 14:48:35 has no hits.

BS32942.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.52.fasta performed 2014-01-22 13:05:41 Download gff for BS32942.complete
Subject Subject Range Query Range Percent Splice Strand
CG14207-RC 26..489 17..480 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 15:23:40 Download gff for BS32942.complete
Subject Subject Range Query Range Percent Splice Strand
CG14207-RC 26..489 17..480 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 15:23:40 Download gff for BS32942.complete
Subject Subject Range Query Range Percent Splice Strand
X 19610696..19610889 287..480 100   Plus
X 19610163..19610254 17..108 100 -> Plus
X 19610381..19610462 109..190 100 -> Plus
X 19610528..19610623 191..286 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2014-01-22 13:05:41 Download gff for BS32942.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 19504196..19504287 17..108 100 -> Plus
arm_X 19504414..19504495 109..190 100 -> Plus
arm_X 19504561..19504656 191..286 100 -> Plus
arm_X 19504729..19504922 287..480 100   Plus

BS32942.pep Sequence

Translation from 16 to 480

> BS32942.pep
MEAFTRTLQNTFRSTRTTRTTTTTTTNSSTSSTTNSALPSRIPKQQNYVS
DISSPLIQDEGDNKVLKLRFDVSQYAPEEIVVKTVDQKLLVHAKHEEKSD
TKSVYREYNREFLLPKGVNPESIRSSLSKDGVLTVDAPLPALTAGETLIP
IAHK*

BS32942.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:53:00
Subject Length Description Subject Range Query Range Score Percent Strand
CG14207-PC 154 CG14207-PC 1..154 1..154 771 100 Plus
CG14207-PB 192 CG14207-PB 54..192 10..154 650 91.7 Plus
CG14207-PD 183 CG14207-PD 58..183 29..154 631 100 Plus
CG14207-PA 183 CG14207-PA 58..183 29..154 631 100 Plus
l(2)efl-PC 187 CG4533-PC 75..161 62..147 194 43.7 Plus