Clone BS32950 Report

Search the DGRC for BS32950

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:329
Well:50
Vector:pDNR-Dual
Associated Gene/Transcripttau-RE
Protein status:BS32950.pep: full length peptide match
Sequenced Size:314

Clone Sequence Records

BS32950.complete Sequence

314 bp assembled on 2014-01-22

GenBank Submission: KX805198

> BS32950.complete
GAAGTTATCAGTCGACATGGCGGATGTCCTGGAGAAAAGCTCACTGCTGG
ATGCTGTGCCACCACTAGGCGACCCCCACCCACCGCTGCCCCACCAGCAG
CTGCAACAGGAAGCAGCAGCAGCAGCAGCAGCAAATGCCGCACCACCAGC
ACCACCGCAGCAGCAACAACCACCACCCCATCAGCTGCAGCAGCAGCAGC
CGCAACAACAGCAACTGCAACAGAAGCCAGCAAATGCGAGGGCTAATCAG
GATCAAAAAGAATCGTCAGGAAATCAAACTAATTCAGTCCTAGAGTAAAA
GCTTTCTAGACCAT

BS32950.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 14:48:50
Subject Length Description Subject Range Query Range Score Percent Strand
tau-RE 282 CG45110-PE 1..282 17..298 1410 100 Plus
tau-RM 1104 CG45110-PM 1..245 17..261 1225 100 Plus
tau-RJ 927 CG45110-PJ 1..245 17..261 1225 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 14:48:51
Subject Length Description Subject Range Query Range Score Percent Strand
tau-RE 1343 CG45110-RE 347..628 17..298 1410 100 Plus
tau-RM 2261 CG45110-RM 366..610 17..261 1225 100 Plus
tau-RJ 2084 CG45110-RJ 366..610 17..261 1225 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 14:48:48
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 27656206..27656449 260..17 1220 100 Minus
3R 32079331 3R 27651569..27651610 298..257 210 100 Minus
Blast to na_te.dros performed on 2014-11-28 14:48:49 has no hits.

BS32950.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.52.fasta performed 2014-01-22 13:05:45 Download gff for BS32950.complete
Subject Subject Range Query Range Percent Splice Strand
tau-RE 347..626 17..296 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 15:23:48 Download gff for BS32950.complete
Subject Subject Range Query Range Percent Splice Strand
tau-RE 347..626 17..296 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 15:23:48 Download gff for BS32950.complete
Subject Subject Range Query Range Percent Splice Strand
3R 27651571..27651606 261..296 100 <- Minus
3R 27656206..27656449 17..260 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2014-01-22 13:05:45 Download gff for BS32950.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 23477293..23477328 261..296 100 <- Minus
arm_3R 23481928..23482171 17..260 100   Minus

BS32950.pep Sequence

Translation from 16 to 297

> BS32950.pep
MADVLEKSSLLDAVPPLGDPHPPLPHQQLQQEAAAAAAANAAPPAPPQQQ
QPPPHQLQQQQPQQQQLQQKPANARANQDQKESSGNQTNSVLE*

BS32950.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:53:08
Subject Length Description Subject Range Query Range Score Percent Strand
tau-PE 93 CG45110-PE 1..93 1..93 483 100 Plus
tau-PH 288 CG45110-PH 1..86 1..86 431 95.3 Plus
tau-PJ 308 CG45110-PJ 1..86 1..86 431 95.3 Plus
tau-PC 349 CG45110-PC 1..86 1..86 431 95.3 Plus
tau-PI 350 CG45110-PI 1..86 1..86 431 95.3 Plus