Clone BS32951 Report

Search the DGRC for BS32951

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:329
Well:51
Vector:pDNR-Dual
Associated Gene/TranscriptCG43445-RA
Protein status:BS32951.pep: full length peptide match
Sequenced Size:227

Clone Sequence Records

BS32951.complete Sequence

227 bp assembled on 2014-01-27

GenBank Submission: KX801427

> BS32951.complete
GAAGTTATCAGTCGACATGCTGCCATCCACAGAGGTCCTCCGGCGATGGC
GTGTATCTTGTATCTGCAGATGCAGTACGGCCTGCAACAACAGCGTCAAC
GTGGCATGCAAAATTGATGGTTTCGTTGGATGTTTGGGTTGGGTTGTGGG
GATTAAGTGGCTGCTTTATGGGCGACCAAGGAGCAGGACATCCAGGGAGC
TAAAAACGTAGAAGCTTTCTAGACCAT

BS32951.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 14:57:16
Subject Length Description Subject Range Query Range Score Percent Strand
CG43445-RA 195 CG43445-PA 1..195 17..211 975 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 14:57:16
Subject Length Description Subject Range Query Range Score Percent Strand
CG43445-RA 598 CG43445-RA 270..464 17..211 975 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 14:57:14
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 17911766..17911911 66..211 730 100 Plus
3R 32079331 3R 17911645..17911694 17..66 250 100 Plus
Blast to na_te.dros performed 2014-11-28 14:57:15
Subject Length Description Subject Range Query Range Score Percent Strand
Doc 4725 Doc DMW1DOC 4725bp Derived from X17551 (g8821) (Rel. 29, Last updated, Version 2). 1729..1805 157..82 103 61 Minus

BS32951.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.52.fasta performed 2014-01-27 12:12:18 Download gff for BS32951.complete
Subject Subject Range Query Range Percent Splice Strand
CG43445-RA 270..464 17..211 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 15:27:42 Download gff for BS32951.complete
Subject Subject Range Query Range Percent Splice Strand
CG43445-RA 270..464 17..211 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 15:27:42 Download gff for BS32951.complete
Subject Subject Range Query Range Percent Splice Strand
3R 17911645..17911694 17..66 100 -> Plus
3R 17911767..17911911 67..211 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2014-01-27 12:12:18 Download gff for BS32951.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 13737367..13737416 17..66 100 -> Plus
arm_3R 13737489..13737633 67..211 100   Plus

BS32951.pep Sequence

Translation from 16 to 210

> BS32951.pep
MLPSTEVLRRWRVSCICRCSTACNNSVNVACKIDGFVGCLGWVVGIKWLL
YGRPRSRTSRELKT*

BS32951.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:57:39
Subject Length Description Subject Range Query Range Score Percent Strand
CG43445-PA 64 CG43445-PA 1..64 1..64 354 100 Plus