BS32960.complete Sequence
212 bp assembled on 2014-01-22
GenBank Submission: KX804168
> BS32960.complete
GAAGTTATCAGTCGACATGTTCACCTTCTGCCATGTTTGCCAACCCTCCT
TGGAAGTCGGGGGACTCCTCCTAATGACTCGGAATATGTTTTGCCGTATT
CGTAGCATTAACATTCCTTCGCAGCCGAAAATGTCTTCAGAACATATAGT
GGATGTTGCGCAAACAGGCTTAAGTAGAACTCATCCGAGTAAGTAGAAGC
TTTCTAGACCAT
BS32960.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 14:48:47
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG43401-RA | 180 | CG43401-PA | 1..180 | 17..196 | 900 | 100 | Plus |
CG43401-RB | 180 | CG43401-PB | 1..180 | 17..196 | 900 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 14:48:47
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG43401-RA | 508 | CG43401-RA | 195..374 | 17..196 | 900 | 100 | Plus |
CG43401-RB | 686 | CG43401-RB | 195..374 | 17..196 | 900 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 14:48:45
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 1428668..1428847 | 17..196 | 900 | 100 | Plus |
Blast to na_te.dros performed on 2014-11-28 14:48:46 has no hits.
BS32960.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.52.fasta performed 2014-01-22 13:05:44 Download gff for
BS32960.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG43401-RB | 200..374 | 22..196 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 15:23:46 Download gff for
BS32960.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG43401-RB | 200..374 | 22..196 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 15:23:46 Download gff for
BS32960.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 1428673..1428847 | 22..196 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2014-01-22 13:05:44 Download gff for
BS32960.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2L | 1428673..1428847 | 22..196 | 100 | | Plus |
BS32960.pep Sequence
Translation from 16 to 195
> BS32960.pep
MFTFCHVCQPSLEVGGLLLMTRNMFCRIRSINIPSQPKMSSEHIVDVAQT
GLSRTHPSK*
BS32960.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:53:05
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG43401-PA | 59 | CG43401-PA | 1..59 | 1..59 | 312 | 100 | Plus |
CG43401-PB | 59 | CG43401-PB | 1..59 | 1..59 | 312 | 100 | Plus |