Clone BS32960 Report

Search the DGRC for BS32960

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:329
Well:60
Vector:pDNR-Dual
Associated Gene/TranscriptCG43401-RA
Protein status:BS32960.pep: full length peptide match
Sequenced Size:212

Clone Sequence Records

BS32960.complete Sequence

212 bp assembled on 2014-01-22

GenBank Submission: KX804168

> BS32960.complete
GAAGTTATCAGTCGACATGTTCACCTTCTGCCATGTTTGCCAACCCTCCT
TGGAAGTCGGGGGACTCCTCCTAATGACTCGGAATATGTTTTGCCGTATT
CGTAGCATTAACATTCCTTCGCAGCCGAAAATGTCTTCAGAACATATAGT
GGATGTTGCGCAAACAGGCTTAAGTAGAACTCATCCGAGTAAGTAGAAGC
TTTCTAGACCAT

BS32960.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 14:48:47
Subject Length Description Subject Range Query Range Score Percent Strand
CG43401-RA 180 CG43401-PA 1..180 17..196 900 100 Plus
CG43401-RB 180 CG43401-PB 1..180 17..196 900 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 14:48:47
Subject Length Description Subject Range Query Range Score Percent Strand
CG43401-RA 508 CG43401-RA 195..374 17..196 900 100 Plus
CG43401-RB 686 CG43401-RB 195..374 17..196 900 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 14:48:45
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 1428668..1428847 17..196 900 100 Plus
Blast to na_te.dros performed on 2014-11-28 14:48:46 has no hits.

BS32960.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.52.fasta performed 2014-01-22 13:05:44 Download gff for BS32960.complete
Subject Subject Range Query Range Percent Splice Strand
CG43401-RB 200..374 22..196 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 15:23:46 Download gff for BS32960.complete
Subject Subject Range Query Range Percent Splice Strand
CG43401-RB 200..374 22..196 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 15:23:46 Download gff for BS32960.complete
Subject Subject Range Query Range Percent Splice Strand
2L 1428673..1428847 22..196 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2014-01-22 13:05:44 Download gff for BS32960.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 1428673..1428847 22..196 100   Plus

BS32960.pep Sequence

Translation from 16 to 195

> BS32960.pep
MFTFCHVCQPSLEVGGLLLMTRNMFCRIRSINIPSQPKMSSEHIVDVAQT
GLSRTHPSK*

BS32960.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:53:05
Subject Length Description Subject Range Query Range Score Percent Strand
CG43401-PA 59 CG43401-PA 1..59 1..59 312 100 Plus
CG43401-PB 59 CG43401-PB 1..59 1..59 312 100 Plus