Clone BS32961 Report

Search the DGRC for BS32961

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:329
Well:61
Vector:pDNR-Dual
Associated Gene/TranscriptCG43449-RA
Protein status:BS32961.pep: full length peptide match
Sequenced Size:269

Clone Sequence Records

BS32961.complete Sequence

269 bp assembled on 2014-01-22

GenBank Submission: KX804858

> BS32961.complete
GAAGTTATCAGTCGACATGAACAATCTGTGGCGCGAAATCGGCTTTATTA
CCAAGCGAAGGCCGAAGAAACATGTGAAAATCATTCGGATCAAGAAACGC
GTTGCCAAATCGAAGAAAGTCTTCAAGCGAAGGCAATATGAACTGATACA
ACTTCATTTGAGAAATCGTATAAAGTATTTAATTATCGAAAATCTGGAGC
AAGCCTTGGCAAAAATCCAAACTAAGAAAGGGATTCAGAAGAGCTTAAAG
TAAAAGCTTTCTAGACCAT

BS32961.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 14:49:10
Subject Length Description Subject Range Query Range Score Percent Strand
CG43449-RB 237 CG43449-PB 1..237 17..253 1185 100 Plus
CG43449-RA 237 CG43449-PA 1..237 17..253 1185 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 14:49:10
Subject Length Description Subject Range Query Range Score Percent Strand
CG43449-RB 937 CG43449-RB 19..255 17..253 1185 100 Plus
CG43449-RA 514 CG43449-RA 19..255 17..253 1185 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 14:49:08
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 11088438..11088674 17..253 1185 100 Plus
Blast to na_te.dros performed 2014-11-28 14:49:09
Subject Length Description Subject Range Query Range Score Percent Strand
accord2 7650 accord2 QBERT 7650bp 1200..1232 167..135 102 78.8 Minus

BS32961.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.52.fasta performed 2014-01-22 13:05:53 Download gff for BS32961.complete
Subject Subject Range Query Range Percent Splice Strand
CG43449-RA 19..253 17..251 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 15:23:57 Download gff for BS32961.complete
Subject Subject Range Query Range Percent Splice Strand
CG43449-RA 19..253 17..251 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 15:23:57 Download gff for BS32961.complete
Subject Subject Range Query Range Percent Splice Strand
3R 11088438..11088672 17..251 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2014-01-22 13:05:53 Download gff for BS32961.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 6914160..6914394 17..251 100   Plus

BS32961.pep Sequence

Translation from 16 to 252

> BS32961.pep
MNNLWREIGFITKRRPKKHVKIIRIKKRVAKSKKVFKRRQYELIQLHLRN
RIKYLIIENLEQALAKIQTKKGIQKSLK*

BS32961.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:53:16
Subject Length Description Subject Range Query Range Score Percent Strand
CG43449-PB 78 CG43449-PB 1..78 1..78 389 100 Plus
CG43449-PA 78 CG43449-PA 1..78 1..78 389 100 Plus