Clone BS32963 Report

Search the DGRC for BS32963

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:329
Well:63
Vector:pDNR-Dual
Associated Gene/TranscriptCG43146-RA
Protein status:BS32963.pep: full length peptide match
Sequenced Size:233

Clone Sequence Records

BS32963.complete Sequence

233 bp assembled on 2014-01-22

GenBank Submission: KX804589

> BS32963.complete
GAAGTTATCAGTCGACATGGAACAGGAACGGGGAACTGCTAACTGGAAAC
AGGGAGCAGCCGGTGGCCAGTTCATCCTCATCACAGCCATAAAAGAGTCC
GCCGCCAACAAAGTTGAAAAAGCGCAGCTCAAGTGGAGCAGCCTCCAGTC
GGCGGAAATGGTTTCGGTTTCGGGTTCGTGGCTCACTTTTTATATTTTAA
AACCTTTTTTTTTTTAGAAGCTTTCTAGACCAT

BS32963.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed on 2014-11-28 14:49:13 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed on 2014-11-28 14:49:14 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 14:49:12
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 13282932..13283133 16..217 1010 100 Plus
Blast to na_te.dros performed on 2014-11-28 14:49:12 has no hits.

BS32963.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.52.fasta performed 2014-01-22 13:05:55 Download gff for BS32963.complete
Subject Subject Range Query Range Percent Splice Strand
CG43146-RA 483..683 17..217 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 15:24:00 Download gff for BS32963.complete
Subject Subject Range Query Range Percent Splice Strand
3L 13282933..13283133 17..217 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 15:24:00 Download gff for BS32963.complete
Subject Subject Range Query Range Percent Splice Strand
3L 13282933..13283133 17..217 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2014-01-22 13:05:55 Download gff for BS32963.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 13276033..13276233 17..217 100   Plus

BS32963.pep Sequence

Translation from 16 to 216

> BS32963.pep
MEQERGTANWKQGAAGGQFILITAIKESAANKVEKAQLKWSSLQSAEMVS
VSGSWLTFYILKPFFF*
Sequence BS32963.pep has no blast hits.