Clone BS32965 Report

Search the DGRC for BS32965

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:329
Well:65
Vector:pDNR-Dual
Associated Gene/TranscriptCG43447-RA
Protein status:BS32965.pep: full length peptide match
Sequenced Size:230

Clone Sequence Records

BS32965.complete Sequence

230 bp assembled on 2014-01-22

GenBank Submission: KX806366

> BS32965.complete
GAAGTTATCAGTCGACATGGGGGCGTGCCCCGGACAGCCGTGCTTTGGCG
CTCAATTAAAACGGAACCAAAGTCAAAAGTCACCGAGCGATATGGGAAGC
CCACGGAGTCCTAGTTCTAGCTGCGATGGATTAACACATCTCCCGGGGCA
ACATCTCTCCCGGCGACAACCCTCATGGCAAGGTCTTTTGCTCGAAGGCT
GGCCTGTCATATAAAAGCTTTCTAGACCAT

BS32965.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 14:49:17
Subject Length Description Subject Range Query Range Score Percent Strand
CG43447-RA 198 CG43447-PA 1..198 17..214 990 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 14:49:17
Subject Length Description Subject Range Query Range Score Percent Strand
CG43447-RA 534 CG43447-RA 96..294 17..215 995 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 14:49:15
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 27440407..27440605 17..215 995 100 Plus
Blast to na_te.dros performed on 2014-11-28 14:49:16 has no hits.

BS32965.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.52.fasta performed 2014-01-22 13:05:57 Download gff for BS32965.complete
Subject Subject Range Query Range Percent Splice Strand
CG43447-RA 96..291 17..212 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 15:24:00 Download gff for BS32965.complete
Subject Subject Range Query Range Percent Splice Strand
CG43447-RA 96..291 17..212 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 15:24:00 Download gff for BS32965.complete
Subject Subject Range Query Range Percent Splice Strand
3R 27440407..27440602 17..212 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2014-01-22 13:05:57 Download gff for BS32965.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 23266129..23266324 17..212 100   Plus

BS32965.pep Sequence

Translation from 16 to 213

> BS32965.pep
MGACPGQPCFGAQLKRNQSQKSPSDMGSPRSPSSSCDGLTHLPGQHLSRR
QPSWQGLLLEGWPVI*

BS32965.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:53:19
Subject Length Description Subject Range Query Range Score Percent Strand
CG43447-PA 65 CG43447-PA 1..65 1..65 362 100 Plus