BS32965.complete Sequence
230 bp assembled on 2014-01-22
GenBank Submission: KX806366
> BS32965.complete
GAAGTTATCAGTCGACATGGGGGCGTGCCCCGGACAGCCGTGCTTTGGCG
CTCAATTAAAACGGAACCAAAGTCAAAAGTCACCGAGCGATATGGGAAGC
CCACGGAGTCCTAGTTCTAGCTGCGATGGATTAACACATCTCCCGGGGCA
ACATCTCTCCCGGCGACAACCCTCATGGCAAGGTCTTTTGCTCGAAGGCT
GGCCTGTCATATAAAAGCTTTCTAGACCAT
BS32965.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 14:49:17
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG43447-RA | 198 | CG43447-PA | 1..198 | 17..214 | 990 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 14:49:17
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG43447-RA | 534 | CG43447-RA | 96..294 | 17..215 | 995 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 14:49:15
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3R | 32079331 | 3R | 27440407..27440605 | 17..215 | 995 | 100 | Plus |
Blast to na_te.dros performed on 2014-11-28 14:49:16 has no hits.
BS32965.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.52.fasta performed 2014-01-22 13:05:57 Download gff for
BS32965.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG43447-RA | 96..291 | 17..212 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 15:24:00 Download gff for
BS32965.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG43447-RA | 96..291 | 17..212 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 15:24:00 Download gff for
BS32965.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3R | 27440407..27440602 | 17..212 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2014-01-22 13:05:57 Download gff for
BS32965.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3R | 23266129..23266324 | 17..212 | 100 | | Plus |
BS32965.pep Sequence
Translation from 16 to 213
> BS32965.pep
MGACPGQPCFGAQLKRNQSQKSPSDMGSPRSPSSSCDGLTHLPGQHLSRR
QPSWQGLLLEGWPVI*
BS32965.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:53:19
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG43447-PA | 65 | CG43447-PA | 1..65 | 1..65 | 362 | 100 | Plus |