Clone BS32968 Report

Search the DGRC for BS32968

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:329
Well:68
Vector:pDNR-Dual
Associated Gene/TranscriptCG43351-RA
Protein status:BS32968.pep: full length peptide match
Sequenced Size:200

Clone Sequence Records

BS32968.complete Sequence

200 bp assembled on 2014-01-22

GenBank Submission: KX802982

> BS32968.complete
GAAGTTATCAGTCGACATGTTGACGCTTACACTTGGATTTGCGATGCAGT
TGCTGCTGTTGATTTCGCTGCTACTGCTACTTCCACTGCCCGGATTTTCG
AGAGAACTAAGGCAGCCCTATAGATACGACAGATACGACGGTAATCCTGG
CCAAAACCAACCAAGGAATTTGGAGCGGAACTGAAAGCTTTCTAGACCAT

BS32968.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 14:49:28
Subject Length Description Subject Range Query Range Score Percent Strand
CG43351-RA 168 CG43351-PA 1..168 17..184 840 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 14:49:29
Subject Length Description Subject Range Query Range Score Percent Strand
CG43351-RA 242 CG43351-RA 14..181 17..184 840 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 14:49:26
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 19030022..19030189 17..184 840 100 Plus
Blast to na_te.dros performed 2014-11-28 14:49:27
Subject Length Description Subject Range Query Range Score Percent Strand
roo 9092 roo DM_ROO 9092bp 1084..1135 89..39 122 73.1 Minus
roo 9092 roo DM_ROO 9092bp 1099..1153 89..33 118 72.4 Minus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6814..6885 89..18 117 62.5 Minus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2326..2386 78..18 116 65.6 Minus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2347..2393 78..33 115 74.5 Minus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2783..2823 83..43 106 73.2 Minus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6712..6770 101..43 106 64.4 Minus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2306..2340 77..43 103 77.1 Minus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2824..2887 81..18 103 66.2 Minus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2626..2685 81..19 101 65.1 Minus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 6847..6892 83..39 101 71.7 Minus
roo 9092 roo DM_ROO 9092bp 1105..1151 89..43 100 68.1 Minus
Dvir\TART 8500 Dvir\TART TARTVIR 8500bp 2805..2842 76..39 100 73.7 Minus

BS32968.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.52.fasta performed 2014-01-22 13:06:02 Download gff for BS32968.complete
Subject Subject Range Query Range Percent Splice Strand
CG43351-RA 19..180 22..183 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 15:24:05 Download gff for BS32968.complete
Subject Subject Range Query Range Percent Splice Strand
CG43351-RA 19..180 22..183 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 15:24:05 Download gff for BS32968.complete
Subject Subject Range Query Range Percent Splice Strand
2R 19030027..19030188 22..183 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2014-01-22 13:06:02 Download gff for BS32968.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 14917532..14917693 22..183 100   Plus

BS32968.pep Sequence

Translation from 16 to 183

> BS32968.pep
MLTLTLGFAMQLLLLISLLLLLPLPGFSRELRQPYRYDRYDGNPGQNQPR
NLERN*

BS32968.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:53:24
Subject Length Description Subject Range Query Range Score Percent Strand
CG43351-PA 55 CG43351-PA 1..55 1..55 284 100 Plus