Clone BS32975 Report

Search the DGRC for BS32975

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:329
Well:75
Vector:pDNR-Dual
Associated Gene/TranscriptCG43233-RA
Protein status:BS32975.pep: gold
Sequenced Size:305

Clone Sequence Records

BS32975.complete Sequence

305 bp assembled on 2014-01-22

GenBank Submission: KX801279

> BS32975.complete
GAAGTTATCAGTCGACATGTGTGTGCGTCTCGTTGGATCCGCTCTCTGTT
GCTGTTGCAAATTGGGCCTCAAGTGCCTGTGCATCTTCGCCTGTTCCACG
GTCGGTGTTCTCGCCATAGTTGCCTTGGTCGTTTACTTTTGTTTCTTCCA
CAACAAATCGGAGGACTCGACCACAAAGTCTCTCTCTGATTCTACTATCG
ATAAGTCCTTGAAGGATAGCATAACTACTGCAACGGAAGCCCCTTCACTC
GTCAGAGGATATCTCCAACAAATGATAGAAAGAATCTAAAAGCTTTCTAG
ACCAT

BS32975.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 14:49:36
Subject Length Description Subject Range Query Range Score Percent Strand
CG43233-RA 273 CG43233-PA 1..273 17..289 1365 100 Plus
CG43233-RB 99 CG43233-PB 1..99 17..119 420 96.1 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 14:49:37
Subject Length Description Subject Range Query Range Score Percent Strand
CG43233-RA 541 CG43233-RA 83..357 17..291 1375 100 Plus
CG43233-RB 537 CG43233-RB 83..353 17..291 1280 98.5 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 14:49:34
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 20472977..20473217 291..51 1205 100 Minus
Blast to na_te.dros performed on 2014-11-28 14:49:35 has no hits.

BS32975.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.52.fasta performed 2014-01-22 13:06:03 Download gff for BS32975.complete
Subject Subject Range Query Range Percent Splice Strand
CG43233-RA 83..353 17..287 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 15:24:09 Download gff for BS32975.complete
Subject Subject Range Query Range Percent Splice Strand
CG43233-RA 83..353 17..287 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 15:24:09 Download gff for BS32975.complete
Subject Subject Range Query Range Percent Splice Strand
2L 20472981..20473216 52..287 100 <- Minus
2L 20473269..20473303 17..51 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2014-01-22 13:06:03 Download gff for BS32975.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 20472981..20473216 52..287 100 <- Minus
arm_2L 20473269..20473303 17..51 100   Minus

BS32975.pep Sequence

Translation from 16 to 288

> BS32975.pep
MCVRLVGSALCCCCKLGLKCLCIFACSTVGVLAIVALVVYFCFFHNKSED
STTKSLSDSTIDKSLKDSITTATEAPSLVRGYLQQMIERI*

BS32975.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:53:27
Subject Length Description Subject Range Query Range Score Percent Strand
CG43233-PA 90 CG43233-PA 1..90 1..90 467 100 Plus