Clone BS32976 Report

Search the DGRC for BS32976

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:329
Well:76
Vector:pDNR-Dual
Associated Gene/TranscriptCG43247-RA
Protein status:BS32976.pep: full length peptide match
Sequenced Size:257

Clone Sequence Records

BS32976.complete Sequence

257 bp assembled on 2014-01-22

GenBank Submission: KX800542

> BS32976.complete
GAAGTTATCAGTCGACATGCTCCGTACCAACTGGTGCAATTGCAGCTACC
GCTTTTCCTCCTTGCATCCTTTTCTCGATTCGTCCTTGGCTTGTGCAATT
TTCTTTGGGCACAACTGTCATTATGGACTTTGGTCAGGCTGCATTCAAGA
TTTGTTGCAATTTATATTTGCCGTGGTGGCTGGGGAGGCGAAACCGCAGC
CTCCTTCTGCGCTCGGCATGTGGAAAGATATTTCCCAATAAAAGCTTTCT
AGACCAT

BS32976.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed on 2014-11-28 14:49:40 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed on 2014-11-28 14:49:41 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 14:49:38
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 15332614..15332840 17..243 1135 100 Plus
Blast to na_te.dros performed on 2014-11-28 14:49:39 has no hits.

BS32976.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.52.fasta performed 2014-01-22 13:06:05 Download gff for BS32976.complete
Subject Subject Range Query Range Percent Splice Strand
CG43247-RA 300..522 17..239 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 15:24:11 Download gff for BS32976.complete
Subject Subject Range Query Range Percent Splice Strand
3L 15332614..15332836 17..239 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 15:24:11 Download gff for BS32976.complete
Subject Subject Range Query Range Percent Splice Strand
3L 15332614..15332836 17..239 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2014-01-22 13:06:05 Download gff for BS32976.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 15325714..15325936 17..239 100   Plus

BS32976.pep Sequence

Translation from 16 to 240

> BS32976.pep
MLRTNWCNCSYRFSSLHPFLDSSLACAIFFGHNCHYGLWSGCIQDLLQFI
FAVVAGEAKPQPPSALGMWKDISQ*
Sequence BS32976.pep has no blast hits.