Clone BS32977 Report

Search the DGRC for BS32977

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:329
Well:77
Vector:pDNR-Dual
Associated Gene/TranscriptCG43230-RA
Protein status:BS32977.pep: full length peptide match
Sequenced Size:271

Clone Sequence Records

BS32977.complete Sequence

271 bp assembled on 2014-01-22

GenBank Submission: KX803838

> BS32977.complete
GAAGTTATCAGTCGACATGCCTTTTAGTCTCTTCACTACCAGCATAGCTG
TAGCTGGTCGGCCTCCAAAGTTCAAGAGCTTTTCGGCAATAACTTTAAAT
AGAAGAGACCCATCTTGTGCCCAAATGGAATTCGGTGCGGCGAAAACCAC
GACGACAGGGTGGAAAACAAGAAACGGGCATCATTAAAAGCTTTCTAGAC
CATTCGTTTGGCGCGCGAACGGCGAGGTAAGTGGTCGATAATCTATAATC
TATAATTCTATTACATTCCAA

BS32977.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 14:49:43
Subject Length Description Subject Range Query Range Score Percent Strand
CG43230-RA 171 CG43230-PA 1..171 17..187 855 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 14:49:44
Subject Length Description Subject Range Query Range Score Percent Strand
CG43230-RA 799 CG43230-RA 141..314 16..189 870 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 14:49:42
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 15215431..15215543 16..128 565 100 Plus
2L 23513712 2L 15215613..15215675 127..189 315 100 Plus
Blast to na_te.dros performed on 2014-11-28 14:49:43 has no hits.

BS32977.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.52.fasta performed 2014-01-22 13:06:07 Download gff for BS32977.complete
Subject Subject Range Query Range Percent Splice Strand
CG43230-RA 142..322 17..197 97   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 15:24:12 Download gff for BS32977.complete
Subject Subject Range Query Range Percent Splice Strand
CG43230-RA 142..322 17..197 97   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 15:24:12 Download gff for BS32977.complete
Subject Subject Range Query Range Percent Splice Strand
2L 15215432..15215542 17..127 100 -> Plus
2L 15215614..15215683 128..197 94   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2014-01-22 13:06:07 Download gff for BS32977.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 15215432..15215542 17..127 100 -> Plus
arm_2L 15215614..15215683 128..197 94   Plus

BS32977.pep Sequence

Translation from 16 to 186

> BS32977.pep
MPFSLFTTSIAVAGRPPKFKSFSAITLNRRDPSCAQMEFGAAKTTTTGWK
TRNGHH*

BS32977.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:53:30
Subject Length Description Subject Range Query Range Score Percent Strand
CG43230-PA 56 CG43230-PA 1..56 1..56 300 100 Plus