BS32977.complete Sequence
271 bp assembled on 2014-01-22
GenBank Submission: KX803838
> BS32977.complete
GAAGTTATCAGTCGACATGCCTTTTAGTCTCTTCACTACCAGCATAGCTG
TAGCTGGTCGGCCTCCAAAGTTCAAGAGCTTTTCGGCAATAACTTTAAAT
AGAAGAGACCCATCTTGTGCCCAAATGGAATTCGGTGCGGCGAAAACCAC
GACGACAGGGTGGAAAACAAGAAACGGGCATCATTAAAAGCTTTCTAGAC
CATTCGTTTGGCGCGCGAACGGCGAGGTAAGTGGTCGATAATCTATAATC
TATAATTCTATTACATTCCAA
BS32977.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 14:49:43
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG43230-RA | 171 | CG43230-PA | 1..171 | 17..187 | 855 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 14:49:44
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG43230-RA | 799 | CG43230-RA | 141..314 | 16..189 | 870 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 14:49:42
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 15215431..15215543 | 16..128 | 565 | 100 | Plus |
2L | 23513712 | 2L | 15215613..15215675 | 127..189 | 315 | 100 | Plus |
Blast to na_te.dros performed on 2014-11-28 14:49:43 has no hits.
BS32977.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.52.fasta performed 2014-01-22 13:06:07 Download gff for
BS32977.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG43230-RA | 142..322 | 17..197 | 97 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 15:24:12 Download gff for
BS32977.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG43230-RA | 142..322 | 17..197 | 97 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 15:24:12 Download gff for
BS32977.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 15215432..15215542 | 17..127 | 100 | -> | Plus |
2L | 15215614..15215683 | 128..197 | 94 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2014-01-22 13:06:07 Download gff for
BS32977.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2L | 15215432..15215542 | 17..127 | 100 | -> | Plus |
arm_2L | 15215614..15215683 | 128..197 | 94 | | Plus |
BS32977.pep Sequence
Translation from 16 to 186
> BS32977.pep
MPFSLFTTSIAVAGRPPKFKSFSAITLNRRDPSCAQMEFGAAKTTTTGWK
TRNGHH*
BS32977.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:53:30
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG43230-PA | 56 | CG43230-PA | 1..56 | 1..56 | 300 | 100 | Plus |