Clone BS32978 Report

Search the DGRC for BS32978

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:329
Well:78
Vector:pDNR-Dual
Associated Gene/TranscriptCG43185-RC
Protein status:BS32978.pep: gold
Sequenced Size:239

Clone Sequence Records

BS32978.complete Sequence

239 bp assembled on 2014-01-22

GenBank Submission: KX801429

> BS32978.complete
GAAGTTATCAGTCGACATGAAGCCGGGCCCATTTACGCAAGTTGACTGTA
CAAACGCCATGCATTTGAGACAACTCCTTACCGAAATGGTTATTATCTTG
ACCATATTGACCATTCCTGGCTATACCATTCACACCTTGGCAGAGAAGAA
AATCAGCCAATATCCTTGGATCCCGAAGACGTCAACGCATATTACACCTT
ATAAGATATCTGGGGATATATGAAAGCTTTCTAGACCAT

BS32978.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 14:47:11
Subject Length Description Subject Range Query Range Score Percent Strand
CG43185-RD 165 CG43185-PD 1..165 59..223 825 100 Plus
CG43185-RC 165 CG43185-PC 1..165 59..223 825 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 14:47:12
Subject Length Description Subject Range Query Range Score Percent Strand
CG43185-RD 477 CG7-RD 179..387 17..225 1045 100 Plus
CG43185-RC 464 CG7-RC 200..408 17..225 1045 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 14:47:10
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 5885265..5885401 89..225 685 100 Plus
2L 23513712 2L 5885131..5885203 17..89 365 100 Plus
Blast to na_te.dros performed on 2014-11-28 14:47:11 has no hits.

BS32978.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.52.fasta performed 2014-01-22 13:05:03 Download gff for BS32978.complete
Subject Subject Range Query Range Percent Splice Strand
CG43185-RB 179..384 17..222 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 15:22:56 Download gff for BS32978.complete
Subject Subject Range Query Range Percent Splice Strand
CG43185-RC 200..405 17..222 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 15:22:56 Download gff for BS32978.complete
Subject Subject Range Query Range Percent Splice Strand
2L 5885131..5885203 17..89 100 -> Plus
2L 5885266..5885398 90..222 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2014-01-22 13:05:03 Download gff for BS32978.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 5885131..5885203 17..89 100 -> Plus
arm_2L 5885266..5885398 90..222 100   Plus

BS32978.pep Sequence

Translation from 16 to 222

> BS32978.pep
MKPGPFTQVDCTNAMHLRQLLTEMVIILTILTIPGYTIHTLAEKKISQYP
WIPKTSTHITPYKISGDI*

BS32978.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:52:13
Subject Length Description Subject Range Query Range Score Percent Strand
CG43185-PD 54 CG43185-PD 1..54 15..68 281 100 Plus
CG43185-PC 54 CG43185-PC 1..54 15..68 281 100 Plus