BS32978.complete Sequence
239 bp assembled on 2014-01-22
GenBank Submission: KX801429
> BS32978.complete
GAAGTTATCAGTCGACATGAAGCCGGGCCCATTTACGCAAGTTGACTGTA
CAAACGCCATGCATTTGAGACAACTCCTTACCGAAATGGTTATTATCTTG
ACCATATTGACCATTCCTGGCTATACCATTCACACCTTGGCAGAGAAGAA
AATCAGCCAATATCCTTGGATCCCGAAGACGTCAACGCATATTACACCTT
ATAAGATATCTGGGGATATATGAAAGCTTTCTAGACCAT
BS32978.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 14:47:11
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG43185-RD | 165 | CG43185-PD | 1..165 | 59..223 | 825 | 100 | Plus |
CG43185-RC | 165 | CG43185-PC | 1..165 | 59..223 | 825 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 14:47:12
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG43185-RD | 477 | CG7-RD | 179..387 | 17..225 | 1045 | 100 | Plus |
CG43185-RC | 464 | CG7-RC | 200..408 | 17..225 | 1045 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 14:47:10
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 5885265..5885401 | 89..225 | 685 | 100 | Plus |
2L | 23513712 | 2L | 5885131..5885203 | 17..89 | 365 | 100 | Plus |
Blast to na_te.dros performed on 2014-11-28 14:47:11 has no hits.
BS32978.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.52.fasta performed 2014-01-22 13:05:03 Download gff for
BS32978.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG43185-RB | 179..384 | 17..222 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 15:22:56 Download gff for
BS32978.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG43185-RC | 200..405 | 17..222 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 15:22:56 Download gff for
BS32978.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 5885131..5885203 | 17..89 | 100 | -> | Plus |
2L | 5885266..5885398 | 90..222 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2014-01-22 13:05:03 Download gff for
BS32978.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2L | 5885131..5885203 | 17..89 | 100 | -> | Plus |
arm_2L | 5885266..5885398 | 90..222 | 100 | | Plus |
BS32978.pep Sequence
Translation from 16 to 222
> BS32978.pep
MKPGPFTQVDCTNAMHLRQLLTEMVIILTILTIPGYTIHTLAEKKISQYP
WIPKTSTHITPYKISGDI*
BS32978.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:52:13
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG43185-PD | 54 | CG43185-PD | 1..54 | 15..68 | 281 | 100 | Plus |
CG43185-PC | 54 | CG43185-PC | 1..54 | 15..68 | 281 | 100 | Plus |