Clone BS32989 Report

Search the DGRC for BS32989

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:329
Well:89
Vector:pDNR-Dual
Associated Gene/TranscriptCG43134-RA
Protein status:BS32989.pep: full length peptide match
Sequenced Size:281

Clone Sequence Records

BS32989.complete Sequence

281 bp assembled on 2014-01-22

GenBank Submission: KX803633

> BS32989.complete
GAAGTTATCAGTCGACATGTTCAACAAAACGATTTTCGTAGCCCTCCTTG
TCTGCGCCTGCTACCTTGGCACAAGTGAGGCTCGCCCAGGACTTACCGAT
GTGGCCTCTGGACCAGTTGGATCAGCCGTGCCATTGGTAACTGGAGCTCT
TGGTGGCCTAACTGGAGGAGTAGCTGGCTCTGCTCTGCCTCAGCTGACTG
GTTCTCTTGGCCAGTCAGGACCTTTGGGATTGGCCCAAGGACCACTTTCA
GGACTTACCGGTTAAAAGCTTTCTAGACCAT

BS32989.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 14:47:28
Subject Length Description Subject Range Query Range Score Percent Strand
CG43134-RA 249 CG43134-PA 1..249 17..265 1230 99.6 Plus
CG43134-RB 249 CG43134-PB 1..249 17..265 1230 99.6 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 14:47:29
Subject Length Description Subject Range Query Range Score Percent Strand
CG43134-RA 407 CG43134-RA 31..279 17..265 1230 99.6 Plus
CG43134-RB 323 CG43134-RB 31..279 17..265 1230 99.6 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 14:47:26
Subject Length Description Subject Range Query Range Score Percent Strand
X 23542271 X 4247448..4247657 56..265 1035 99.5 Plus
X 23542271 X 4247343..4247382 17..56 200 100 Plus
Blast to na_te.dros performed on 2014-11-28 14:47:27 has no hits.

BS32989.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.52.fasta performed 2014-01-22 13:05:11 Download gff for BS32989.complete
Subject Subject Range Query Range Percent Splice Strand
CG43134-RB 36..277 22..263 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 15:23:04 Download gff for BS32989.complete
Subject Subject Range Query Range Percent Splice Strand
CG43134-RB 36..277 22..263 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 15:23:04 Download gff for BS32989.complete
Subject Subject Range Query Range Percent Splice Strand
X 4247348..4247382 22..56 100 -> Plus
X 4247449..4247655 57..263 99   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2014-01-22 13:05:11 Download gff for BS32989.complete
Subject Subject Range Query Range Percent Splice Strand
arm_X 4141482..4141688 57..263 99   Plus
arm_X 4141381..4141415 22..56 100 -> Plus

BS32989.pep Sequence

Translation from 16 to 264

> BS32989.pep
MFNKTIFVALLVCACYLGTSEARPGLTDVASGPVGSAVPLVTGALGGLTG
GVAGSALPQLTGSLGQSGPLGLAQGPLSGLTG*

BS32989.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:52:23
Subject Length Description Subject Range Query Range Score Percent Strand
CG43134-PA 82 CG43134-PA 1..82 1..82 415 100 Plus
CG43134-PB 82 CG43134-PB 1..82 1..82 415 100 Plus