Clone BS32990 Report

Search the DGRC for BS32990

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:329
Well:90
Vector:pDNR-Dual
Associated Gene/TranscriptCG43147-RB
Protein status:BS32990.pep: gold
Sequenced Size:167

Clone Sequence Records

BS32990.complete Sequence

167 bp assembled on 2014-01-22

GenBank Submission: KX800227

> BS32990.complete
GAAGTTATCAGTCGACATGAAGCTACAGCTATTGGTAGTAGTACTTCTTG
GTCTTTTGGCAGTGTCCACGGCCGCACGAAAGAAAGACAAAAAAAACATT
GAGATCTGGATAAGACCGAAGCCAATGGGCTTGCCACCAGAACCGTATTA
GAAGCTTTCTAGACCAT

BS32990.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 14:47:31
Subject Length Description Subject Range Query Range Score Percent Strand
CG43147-RC 135 CG43147-PC 1..135 17..151 675 100 Plus
CG43147-RB 135 CG43147-PB 1..135 17..151 675 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 14:47:31
Subject Length Description Subject Range Query Range Score Percent Strand
CG43147-RC 260 CG43147-RC 2..137 17..152 680 100 Plus
CG43147-RB 256 CG43147-RB 2..137 17..152 680 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 14:47:29
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 13300016..13300151 152..17 680 100 Minus
Blast to na_te.dros performed on 2014-11-28 14:47:30 has no hits.

BS32990.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.52.fasta performed 2014-01-22 13:05:12 Download gff for BS32990.complete
Subject Subject Range Query Range Percent Splice Strand
CG43147-RB 2..136 17..151 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 15:23:06 Download gff for BS32990.complete
Subject Subject Range Query Range Percent Splice Strand
CG43147-RB 2..136 17..151 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 15:23:06 Download gff for BS32990.complete
Subject Subject Range Query Range Percent Splice Strand
3L 13300017..13300151 17..151 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2014-01-22 13:05:12 Download gff for BS32990.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 13293117..13293251 17..151 100   Minus

BS32990.pep Sequence

Translation from 16 to 150

> BS32990.pep
MKLQLLVVVLLGLLAVSTAARKKDKKNIEIWIRPKPMGLPPEPY*

BS32990.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:52:24
Subject Length Description Subject Range Query Range Score Percent Strand
CG43147-PC 44 CG43147-PC 1..44 1..44 223 100 Plus
CG43147-PB 44 CG43147-PB 1..44 1..44 223 100 Plus