BS32990.complete Sequence
167 bp assembled on 2014-01-22
GenBank Submission: KX800227
> BS32990.complete
GAAGTTATCAGTCGACATGAAGCTACAGCTATTGGTAGTAGTACTTCTTG
GTCTTTTGGCAGTGTCCACGGCCGCACGAAAGAAAGACAAAAAAAACATT
GAGATCTGGATAAGACCGAAGCCAATGGGCTTGCCACCAGAACCGTATTA
GAAGCTTTCTAGACCAT
BS32990.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 14:47:31
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG43147-RC | 135 | CG43147-PC | 1..135 | 17..151 | 675 | 100 | Plus |
CG43147-RB | 135 | CG43147-PB | 1..135 | 17..151 | 675 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 14:47:31
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG43147-RC | 260 | CG43147-RC | 2..137 | 17..152 | 680 | 100 | Plus |
CG43147-RB | 256 | CG43147-RB | 2..137 | 17..152 | 680 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 14:47:29
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28110227 | 3L | 13300016..13300151 | 152..17 | 680 | 100 | Minus |
Blast to na_te.dros performed on 2014-11-28 14:47:30 has no hits.
BS32990.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.52.fasta performed 2014-01-22 13:05:12 Download gff for
BS32990.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG43147-RB | 2..136 | 17..151 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 15:23:06 Download gff for
BS32990.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG43147-RB | 2..136 | 17..151 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 15:23:06 Download gff for
BS32990.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 13300017..13300151 | 17..151 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2014-01-22 13:05:12 Download gff for
BS32990.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3L | 13293117..13293251 | 17..151 | 100 | | Minus |
BS32990.pep Sequence
Translation from 16 to 150
> BS32990.pep
MKLQLLVVVLLGLLAVSTAARKKDKKNIEIWIRPKPMGLPPEPY*
BS32990.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:52:24
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG43147-PC | 44 | CG43147-PC | 1..44 | 1..44 | 223 | 100 | Plus |
CG43147-PB | 44 | CG43147-PB | 1..44 | 1..44 | 223 | 100 | Plus |