Clone BS32995 Report

Search the DGRC for BS32995

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:329
Well:95
Vector:pDNR-Dual
Associated Gene/TranscriptCG43235-RA
Protein status:BS32995.pep: full length peptide match
Sequenced Size:344

Clone Sequence Records

BS32995.complete Sequence

344 bp assembled on 2014-01-22

GenBank Submission: KX800880

> BS32995.complete
GAAGTTATCAGTCGACATGCGTCCACAGATTGCAATGTTACTATTGATAA
CTGCTTGGAAAAGTAGCCTATCAGATCCGATAGGTCCCCGTTCCTATGAA
AACTATTCAGTGTATAAGGTTTTCATTAAAACTCGGTCGGATCAACAGGT
TATCGATGGACTGCTGAAGGACACAGACAATTATAACTTGTGGCATCGTG
GCTTAAATGTAGTTCACATAATGGTGAGCCCTGTGGAAAAGGATTCTTTC
CTAGCTGTAATGCAAAAGGAAAATATTGTTGTGGAAGTACTTATAAAAAA
TGTTCAGACACTTATTGATAGATACTGAAAGCTTTCTAGACCAT

BS32995.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 14:47:37
Subject Length Description Subject Range Query Range Score Percent Strand
CG43235-RA 312 CG43235-PA 1..312 17..328 1560 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 14:47:38
Subject Length Description Subject Range Query Range Score Percent Strand
CG43235-RA 678 CG43235-RA 107..425 10..328 1565 99.4 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 14:47:36
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 7693136..7693307 10..181 830 98.8 Plus
2L 23513712 2L 7693365..7693492 182..309 640 100 Plus
Blast to na_te.dros performed on 2014-11-28 14:47:36 has no hits.

BS32995.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.52.fasta performed 2014-01-22 13:05:17 Download gff for BS32995.complete
Subject Subject Range Query Range Percent Splice Strand
CG43235-RA 114..424 17..327 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 15:23:11 Download gff for BS32995.complete
Subject Subject Range Query Range Percent Splice Strand
CG43235-RA 114..424 17..327 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 15:23:11 Download gff for BS32995.complete
Subject Subject Range Query Range Percent Splice Strand
2L 7693365..7693492 182..309 100 -> Plus
2L 7693550..7693567 310..327 100   Plus
2L 7693143..7693307 17..181 100 -> Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2014-01-22 13:05:17 Download gff for BS32995.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 7693143..7693307 17..181 100 -> Plus
arm_2L 7693365..7693492 182..309 100 -> Plus
arm_2L 7693550..7693567 310..327 100   Plus

BS32995.pep Sequence

Translation from 16 to 327

> BS32995.pep
MRPQIAMLLLITAWKSSLSDPIGPRSYENYSVYKVFIKTRSDQQVIDGLL
KDTDNYNLWHRGLNVVHIMVSPVEKDSFLAVMQKENIVVEVLIKNVQTLI
DRY*

BS32995.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:52:27
Subject Length Description Subject Range Query Range Score Percent Strand
CG43235-PA 103 CG43235-PA 1..103 1..103 526 100 Plus
CG7025-PA 429 CG7025-PA 8..103 5..101 166 36.1 Plus