Clone BS33057 Report

Search the DGRC for BS33057

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:330
Well:57
Vector:pDNR-Dual
Associated Gene/Transcriptpes-RE
Protein status:BS33057.pep: gold
Sequenced Size:296

Clone Sequence Records

BS33057.complete Sequence

296 bp assembled on 2014-01-22

GenBank Submission: KX803688

> BS33057.complete
GAAGTTATCAGTCGACATGACATCACGGACGCGCCACTGTGCCCGACTGG
GGATCGTTCTCCTTGGGATCTGTTGCATCGCCAGCGGAATTTACCTCTTC
CGCAACTGGATCGATATGTTTACACGCATGCGCGGCCAGACCTTTGGGTT
AAGTTTCGCAAGCCGGCAAATTGGCAATGTGTGCAGAGGTCAACTGGGAG
ACTCATTTGCATACCACTTGGATTGGGAGGCAACAATTTTTTCCATTGAT
TTAAAGCAAAGACGAACGCAAAGACACTGAAAGCTTTCTAGACCAT

BS33057.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 14:50:26
Subject Length Description Subject Range Query Range Score Percent Strand
pes-RE 264 CG7228-PE 1..264 17..280 1320 100 Plus
pes-RF 1668 CG7228-PF 1..123 17..139 615 100 Plus
pes-RH 1668 CG7228-PH 1..123 17..139 615 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 14:50:27
Subject Length Description Subject Range Query Range Score Percent Strand
pes-RE 519 CG7228-RE 101..366 17..282 1330 100 Plus
pes-RF 2532 CG7228-RF 101..223 17..139 615 100 Plus
pes-RH 2653 CG7228-RH 222..344 17..139 615 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 14:50:24
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 7991117..7991262 282..137 730 100 Minus
2L 23513712 2L 7991358..7991480 139..17 615 100 Minus
Blast to na_te.dros performed on 2014-11-28 14:50:25 has no hits.

BS33057.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.52.fasta performed 2014-01-22 13:06:26 Download gff for BS33057.complete
Subject Subject Range Query Range Percent Splice Strand
pes-RE 101..363 17..279 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 15:24:27 Download gff for BS33057.complete
Subject Subject Range Query Range Percent Splice Strand
pes-RE 101..363 17..279 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 15:24:27 Download gff for BS33057.complete
Subject Subject Range Query Range Percent Splice Strand
2L 7991120..7991259 140..279 100 <- Minus
2L 7991358..7991480 17..139 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2014-01-22 13:06:26 Download gff for BS33057.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 7991358..7991480 17..139 100   Minus
arm_2L 7991120..7991259 140..279 100 <- Minus

BS33057.pep Sequence

Translation from 16 to 279

> BS33057.pep
MTSRTRHCARLGIVLLGICCIASGIYLFRNWIDMFTRMRGQTFGLSFASR
QIGNVCRGQLGDSFAYHLDWEATIFSIDLKQRRTQRH*

BS33057.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:53:51
Subject Length Description Subject Range Query Range Score Percent Strand
pes-PE 87 CG7228-PE 1..87 1..87 467 100 Plus
pes-PF 555 CG7228-PF 1..50 1..50 232 90 Plus
pes-PH 555 CG7228-PH 1..50 1..50 232 90 Plus
pes-PG 555 CG7228-PG 1..50 1..50 232 90 Plus
pes-PD 555 CG7228-PD 1..50 1..50 232 90 Plus