Clone BS33064 Report

Search the DGRC for BS33064

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:330
Well:64
Vector:pDNR-Dual
Associated Gene/TranscriptCG43407-RA
Protein status:BS33064.pep: gold
Sequenced Size:164

Clone Sequence Records

BS33064.complete Sequence

164 bp assembled on 2014-01-22

GenBank Submission: KX804063

> BS33064.complete
GAAGTTATCAGTCGACATGGGCGAATGTGTGAGGTGGCCGCCTGCGGACC
GGGCTGAAATGAACATGCACACATGCTGGCGAAGGGGCGGAGAAAATTTC
AGAGGAGGGGGAGTGCCCAGAGCAGGAGGATCGGGTCTGTCCAGCTAAAA
GCTTTCTAGACCAT

BS33064.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 14:50:38
Subject Length Description Subject Range Query Range Score Percent Strand
CG43407-RA 132 CG43407-PA 1..132 17..148 660 100 Plus
CG43407-RB 132 CG43407-PB 1..132 17..148 660 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 14:50:38
Subject Length Description Subject Range Query Range Score Percent Strand
CG43407-RA 368 CG43407-RA 93..224 17..148 660 100 Plus
CG43407-RB 488 CG43407-RB 93..224 17..148 660 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 14:50:36
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 19053166..19053297 148..17 660 100 Minus
Blast to na_te.dros performed on 2014-11-28 14:50:37 has no hits.

BS33064.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.52.fasta performed 2014-01-22 13:06:31 Download gff for BS33064.complete
Subject Subject Range Query Range Percent Splice Strand
CG43407-RB 93..222 17..146 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 15:24:31 Download gff for BS33064.complete
Subject Subject Range Query Range Percent Splice Strand
CG43407-RB 93..222 17..146 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 15:24:31 Download gff for BS33064.complete
Subject Subject Range Query Range Percent Splice Strand
3L 19053168..19053297 17..146 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2014-01-22 13:06:31 Download gff for BS33064.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 19046268..19046397 17..146 100   Minus

BS33064.pep Sequence

Translation from 16 to 147

> BS33064.pep
MGECVRWPPADRAEMNMHTCWRRGGENFRGGGVPRAGGSGLSS*

BS33064.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:53:56
Subject Length Description Subject Range Query Range Score Percent Strand
CG43407-PA 43 CG43407-PA 1..43 1..43 248 100 Plus
CG43407-PB 43 CG43407-PB 1..43 1..43 248 100 Plus