Clone BS33073 Report

Search the DGRC for BS33073

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:330
Well:73
Vector:pDNR-Dual
Associated Gene/TranscriptCG43250-RA
Protein status:BS33073.pep: full length peptide match
Sequenced Size:254

Clone Sequence Records

BS33073.complete Sequence

254 bp assembled on 2014-01-22

GenBank Submission: KX804669

> BS33073.complete
GAAGTTATCAGTCGACATGATGACGCCCGATCCAGAACAACCGTTAAGTG
CTCCACCCCAAATGATGCTGCAACAGGGTGAGCGAAAGAGAGGGCGAGCC
CGATACCGAAAGAGACAGAGGCAGAGCCGAACAGAAACGACAGTGAAAGT
TCTACACTTTCGCTTTTTCACAGAACCCTGCTATCATACGAAAAGCAGCA
ATCGTAGAGATAGAAACCTTTGGAAATACAATACATAGAAGCTTTCTAGA
CCAT

BS33073.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed on 2014-11-28 14:50:46 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed on 2014-11-28 14:50:46 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 14:50:44
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 17033388..17033609 238..17 1110 100 Minus
Blast to na_te.dros performed on 2014-11-28 14:50:45 has no hits.

BS33073.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.52.fasta performed 2014-01-22 13:06:35 Download gff for BS33073.complete
Subject Subject Range Query Range Percent Splice Strand
CG43250-RA 68..289 17..238 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 15:24:35 Download gff for BS33073.complete
Subject Subject Range Query Range Percent Splice Strand
3L 17033388..17033609 17..238 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 15:24:35 Download gff for BS33073.complete
Subject Subject Range Query Range Percent Splice Strand
3L 17033388..17033609 17..238 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2014-01-22 13:06:35 Download gff for BS33073.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 17026488..17026709 17..238 100   Minus

BS33073.pep Sequence

Translation from 16 to 237

> BS33073.pep
MMTPDPEQPLSAPPQMMLQQGERKRGRARYRKRQRQSRTETTVKVLHFRF
FTEPCYHTKSSNRRDRNLWKYNT*
Sequence BS33073.pep has no blast hits.