Clone BS33138 Report

Search the DGRC for BS33138

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:331
Well:38
Vector:pDNR-Dual
Associated Gene/TranscriptCG43253-RA
Protein status:BS33138.pep: full length peptide match
Sequenced Size:224

Clone Sequence Records

BS33138.complete Sequence

224 bp assembled on 2014-01-22

GenBank Submission: KX800430

> BS33138.complete
GAAGTTATCAGTCGACATGCCCAGCTCCATGATGTCCGTGATGATGATTA
CGCTGCACTCGCTGAGCCTGAGCTGGATTTTTAATTGGCCTAGTCCATTG
AGTGCTCCATTTGCCGGTTTCCCATCTGTGTACTCATCAGATATCTGCTG
GCCAAGGTGCCAGTGGGGTGAATTGCAGGGCAGATGCCCAACGATAATGG
ACAGCTGAAAGCTTTCTAGACCAT

BS33138.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed on 2014-11-28 14:52:25 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed on 2014-11-28 14:52:26 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 14:52:24
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 18081338..18081529 208..17 960 100 Minus
Blast to na_te.dros performed on 2014-11-28 14:52:24 has no hits.

BS33138.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.52.fasta performed 2014-01-22 13:26:55 Download gff for BS33138.complete
Subject Subject Range Query Range Percent Splice Strand
CG43253-RA 420..610 17..207 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 15:25:19 Download gff for BS33138.complete
Subject Subject Range Query Range Percent Splice Strand
3L 18081339..18081529 17..207 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 15:25:19 Download gff for BS33138.complete
Subject Subject Range Query Range Percent Splice Strand
3L 18081339..18081529 17..207 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2014-01-22 13:26:55 Download gff for BS33138.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 18074439..18074629 17..207 100   Minus

BS33138.pep Sequence

Translation from 16 to 207

> BS33138.pep
MPSSMMSVMMITLHSLSLSWIFNWPSPLSAPFAGFPSVYSSDICWPRCQW
GELQGRCPTIMDS*
Sequence BS33138.pep has no blast hits.