Clone BS33142 Report

Search the DGRC for BS33142

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:331
Well:42
Vector:pDNR-Dual
Associated Gene/TranscriptCG43389-RA
Protein status:BS33142.pep: full length peptide match
Sequenced Size:179

Clone Sequence Records

BS33142.complete Sequence

179 bp assembled on 2014-01-22

GenBank Submission: KX800946

> BS33142.complete
GAAGTTATCAGTCGACATGCGAAACAACCAGGCAGACAACACCCAACGGC
AAAAACTCGGCCTGGAGAGAAAGAGGCAGTGGCAGCGACGCGTCTGGGGG
CTTACAATGGCGGTCGCAACACTAGTGGCGCTTGTAAATAGAGACATAAC
GAAAAGGTATTAAAAGCTTTCTAGACCAT

BS33142.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 14:52:39
Subject Length Description Subject Range Query Range Score Percent Strand
CG43389-RA 147 CG43389-PA 1..147 17..163 735 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 14:52:40
Subject Length Description Subject Range Query Range Score Percent Strand
CG43389-RA 923 CG43389-RA 543..691 17..165 745 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 14:52:37
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 3248664..3248812 17..165 745 100 Plus
Blast to na_te.dros performed on 2014-11-28 14:52:38 has no hits.

BS33142.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.52.fasta performed 2014-01-22 13:27:03 Download gff for BS33142.complete
Subject Subject Range Query Range Percent Splice Strand
CG43389-RA 543..687 17..161 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 15:25:25 Download gff for BS33142.complete
Subject Subject Range Query Range Percent Splice Strand
CG43389-RA 543..687 17..161 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 15:25:25 Download gff for BS33142.complete
Subject Subject Range Query Range Percent Splice Strand
3L 3248664..3248808 17..161 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2014-01-22 13:27:03 Download gff for BS33142.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 3248664..3248808 17..161 100   Plus

BS33142.pep Sequence

Translation from 16 to 162

> BS33142.pep
MRNNQADNTQRQKLGLERKRQWQRRVWGLTMAVATLVALVNRDITKRY*

BS33142.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:54:52
Subject Length Description Subject Range Query Range Score Percent Strand
CG43389-PA 48 CG43389-PA 1..48 1..48 248 100 Plus