BS33142.complete Sequence
179 bp assembled on 2014-01-22
GenBank Submission: KX800946
> BS33142.complete
GAAGTTATCAGTCGACATGCGAAACAACCAGGCAGACAACACCCAACGGC
AAAAACTCGGCCTGGAGAGAAAGAGGCAGTGGCAGCGACGCGTCTGGGGG
CTTACAATGGCGGTCGCAACACTAGTGGCGCTTGTAAATAGAGACATAAC
GAAAAGGTATTAAAAGCTTTCTAGACCAT
BS33142.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 14:52:39
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG43389-RA | 147 | CG43389-PA | 1..147 | 17..163 | 735 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 14:52:40
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG43389-RA | 923 | CG43389-RA | 543..691 | 17..165 | 745 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 14:52:37
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
3L | 28110227 | 3L | 3248664..3248812 | 17..165 | 745 | 100 | Plus |
Blast to na_te.dros performed on 2014-11-28 14:52:38 has no hits.
BS33142.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.52.fasta performed 2014-01-22 13:27:03 Download gff for
BS33142.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG43389-RA | 543..687 | 17..161 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 15:25:25 Download gff for
BS33142.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG43389-RA | 543..687 | 17..161 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 15:25:25 Download gff for
BS33142.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
3L | 3248664..3248808 | 17..161 | 100 | | Plus |
Sim4 to na_arms.dmel.RELEASE5 performed 2014-01-22 13:27:03 Download gff for
BS33142.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_3L | 3248664..3248808 | 17..161 | 100 | | Plus |
BS33142.pep Sequence
Translation from 16 to 162
> BS33142.pep
MRNNQADNTQRQKLGLERKRQWQRRVWGLTMAVATLVALVNRDITKRY*
BS33142.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:54:52
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG43389-PA | 48 | CG43389-PA | 1..48 | 1..48 | 248 | 100 | Plus |