Clone BS33143 Report

Search the DGRC for BS33143

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:331
Well:43
Vector:pDNR-Dual
Associated Gene/TranscriptCG43949-RA
Protein status:BS33143.pep: full length peptide match
Sequenced Size:281

Clone Sequence Records

BS33143.complete Sequence

281 bp assembled on 2014-01-22

GenBank Submission: KX801937

> BS33143.complete
GAAGTTATCAGTCGACATGCACAACTTTATTATCGGTTCGGCCCAGTCAC
GGTCACGTCCTTTGATCCTTTTGCCCGATTTCAGGATCCGCTGCACAACT
GTTCTCCGGTGTTTTTTCATCTTTATTTTGCGAAAAACCAAAGCGTCCGC
TCGCTGTGGGAAACGCAACAGGTGCGCCGAGGCTCCAGCATCCAGAATCC
AGCATCCAATCTCCAGTCGGCAGCAGCATTTCTCATCCATCAGCCGGCGG
AGCGAGCATCTTTAAAAGCTTTCTAGACCAT

BS33143.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed on 2014-11-28 14:52:42 has no hits.
Blast to dmel-all-transcript-r6.02.fasta performed on 2014-11-28 14:52:43 has no hits.
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 14:52:41
Subject Length Description Subject Range Query Range Score Percent Strand
3L 28110227 3L 16020549..16020797 265..17 1245 100 Minus
Blast to na_te.dros performed on 2014-11-28 14:52:41 has no hits.

BS33143.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.52.fasta performed 2014-01-22 13:27:04 Download gff for BS33143.complete
Subject Subject Range Query Range Percent Splice Strand
CG43949-RA 710..956 17..263 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 15:25:27 Download gff for BS33143.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16020551..16020797 17..263 100   Minus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 15:25:27 Download gff for BS33143.complete
Subject Subject Range Query Range Percent Splice Strand
3L 16020551..16020797 17..263 100   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2014-01-22 13:27:04 Download gff for BS33143.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3L 16013651..16013897 17..263 100   Minus

BS33143.pep Sequence

Translation from 16 to 264

> BS33143.pep
MHNFIIGSAQSRSRPLILLPDFRIRCTTVLRCFFIFILRKTKASARCGKR
NRCAEAPASRIQHPISSRQQHFSSISRRSEHL*
Sequence BS33143.pep has no blast hits.