Clone BS33147 Report

Search the DGRC for BS33147

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:331
Well:47
Vector:pDNR-Dual
Associated Gene/Transcriptcpx-RZ
Protein status:BS33147.pep: full length peptide match
Sequenced Size:329

Clone Sequence Records

BS33147.complete Sequence

329 bp assembled on 2014-01-22

GenBank Submission: KX802575

> BS33147.complete
GAAGTTATCAGTCGACATGGAGGAGGAGCGCGAGAAGATGAGGCAAGACA
TTCGCGATAAGTACAACATCAAGAAGAAGGAGGAGATCGTGGAGGCGGCC
CCCCAAGAAGAGCCCAATCCCCTGATGCGGAAAAAGAAGACGCCCGAGGA
ACTCGCCGCCGAAGCGGAGCAGGAAGAGCTCGACGATTTTACAAGTAAGT
CTTTGCTGCCACTGTCAAGTGCCGTTGAACCTGGCTCAGCTAGTGGCATC
TATATACTGCAATTGCAACCCACTAATTTCTCCGCTCCGATTGCTCCTGC
TCCTATTCTATAAAAGCTTTCTAGACCAT

BS33147.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 14:52:18
Subject Length Description Subject Range Query Range Score Percent Strand
cpx-RAB 474 CG32490-PAB 178..474 17..313 1485 100 Plus
cpx-RZ 297 CG32490-PZ 1..297 17..313 1485 100 Plus
cpx-RAA 378 CG32490-PAA 127..304 17..194 890 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 14:52:19
Subject Length Description Subject Range Query Range Score Percent Strand
cpx-RAB 9682 CG32490-RB 601..897 17..313 1485 100 Plus
cpx-RZ 2094 CG32490-RZ 655..951 17..313 1485 100 Plus
cpx-RAA 3803 CG32490-RA 449..626 17..194 890 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 14:52:16
Subject Length Description Subject Range Query Range Score Percent Strand
3R 32079331 3R 4295566..4295819 60..313 1270 100 Plus
3R 32079331 3R 4295242..4295286 17..61 225 100 Plus
Blast to na_te.dros performed on 2014-11-28 14:52:17 has no hits.

BS33147.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.52.fasta performed 2014-01-22 13:26:51 Download gff for BS33147.complete
Subject Subject Range Query Range Percent Splice Strand
cpx-RZ 425..719 17..311 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 15:25:14 Download gff for BS33147.complete
Subject Subject Range Query Range Percent Splice Strand
cpx-RZ 655..949 17..311 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 15:25:14 Download gff for BS33147.complete
Subject Subject Range Query Range Percent Splice Strand
3R 4295242..4295286 17..61 100 -> Plus
3R 4295568..4295817 62..311 100   Plus
Sim4 to na_arms.dmel.RELEASE5 performed 2014-01-22 13:26:51 Download gff for BS33147.complete
Subject Subject Range Query Range Percent Splice Strand
arm_3R 120964..121008 17..61 100 -> Plus
arm_3R 121290..121539 62..311 100   Plus

BS33147.pep Sequence

Translation from 16 to 312

> BS33147.pep
MEEEREKMRQDIRDKYNIKKKEEIVEAAPQEEPNPLMRKKKTPEELAAEA
EQEELDDFTSKSLLPLSSAVEPGSASGIYILQLQPTNFSAPIAPAPIL*

BS33147.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:54:43
Subject Length Description Subject Range Query Range Score Percent Strand
cpx-PZ 98 CG32490-PZ 1..98 1..98 490 100 Plus
cpx-PAB 157 CG32490-PAB 60..157 1..98 490 100 Plus
cpx-PE 138 CG32490-PE 60..128 1..69 310 91.3 Plus
cpx-PK 83 CG32490-PK 1..59 1..59 300 100 Plus
cpx-PJ 83 CG32490-PJ 1..59 1..59 300 100 Plus