BS33150.complete Sequence
392 bp assembled on 2014-01-22
GenBank Submission: KX801248
> BS33150.complete
GAAGTTATCAGTCGACATGTTCAAAAACCACTTGGAAATGATTGGGCGCA
ATGAGAGCCCCAGCAAGAAGGCGAAATTCTGGCAGTCCTACATCAGGTCC
CTGAAGGGCTCCGAGGATATCCGTGCCCACGAGGCGCCCCGTGCCTCTCG
TCCCTACAGCTCCTACCTGGACTCGCCCTCCTACAGGAGCATCTATGACG
AGCCCGCCACCGCCAATGAGCGCGTCCAGTCCTCTGGCTACAGATATCTG
CCAGTGAGCCGCGACACCTACGGCTACTCGCCCCGTGCCATCTACGATCA
TCACTACAGCCGAACAAGTAAGTTGGTACCATATACGGACCACATACTGT
ACTATCTACAGCCGATTCCCGCCTAAAAGCTTTCTAGACCAT
BS33150.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 14:53:04
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| Mf-RP | 360 | CG6803-PP | 1..360 | 17..376 | 1800 | 100 | Plus |
| Mf-RK | 360 | CG6803-PK | 1..360 | 17..376 | 1800 | 100 | Plus |
| Mf-RO | 933 | CG6803-PO | 1..305 | 17..321 | 1510 | 99.7 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 14:53:05
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| Mf-RP | 2827 | CG6803-RP | 85..444 | 17..376 | 1800 | 100 | Plus |
| Mf-RK | 2535 | CG553-RK | 85..444 | 17..376 | 1800 | 100 | Plus |
| Mf-RO | 1777 | CG6803-RO | 115..419 | 17..321 | 1510 | 99.7 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 14:53:02
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| 3R | 32079331 | 3R | 15178221..15178490 | 376..107 | 1350 | 100 | Minus |
| 3R | 32079331 | 3R | 15179038..15179129 | 108..17 | 460 | 100 | Minus |
Blast to na_te.dros performed on 2014-11-28 14:53:03 has no hits.
BS33150.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.52.fasta performed 2014-01-22 13:27:15 Download gff for
BS33150.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| Mf-RK | 90..442 | 22..374 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 15:25:37 Download gff for
BS33150.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| Mf-RK | 90..442 | 22..374 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 15:25:37 Download gff for
BS33150.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| 3R | 15178223..15178489 | 108..374 | 100 | <- | Minus |
| 3R | 15179039..15179124 | 22..107 | 100 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2014-01-22 13:27:15 Download gff for
BS33150.complete
| Subject | Subject Range | Query Range | Percent | Splice | Strand |
|---|
| arm_3R | 11003945..11004211 | 108..374 | 100 | <- | Minus |
| arm_3R | 11004761..11004846 | 22..107 | 100 | | Minus |
BS33150.pep Sequence
Translation from 16 to 375
> BS33150.pep
MFKNHLEMIGRNESPSKKAKFWQSYIRSLKGSEDIRAHEAPRASRPYSSY
LDSPSYRSIYDEPATANERVQSSGYRYLPVSRDTYGYSPRAIYDHHYSRT
SKLVPYTDHILYYLQPIPA*
BS33150.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:55:03
| Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
|---|
| Mf-PP | 119 | CG6803-PP | 1..119 | 1..119 | 637 | 100 | Plus |
| Mf-PK | 119 | CG6803-PK | 1..119 | 1..119 | 637 | 100 | Plus |
| Mf-PN | 157 | CG6803-PN | 1..108 | 1..110 | 543 | 93.6 | Plus |
| Mf-PG | 157 | CG6803-PG | 1..108 | 1..110 | 543 | 93.6 | Plus |
| Mf-PA | 157 | CG6803-PA | 1..108 | 1..110 | 543 | 93.6 | Plus |
