Clone BS33157 Report

Search the DGRC for BS33157

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:331
Well:57
Vector:pDNR-Dual
Associated Gene/TranscriptCG44476-RA
Protein status:BS33157.pep: full length peptide match
Sequenced Size:266

Clone Sequence Records

BS33157.complete Sequence

266 bp assembled on 2014-01-22

GenBank Submission: KX803464

> BS33157.complete
GAAGTTATCAGTCGACATGGGTGAAGAAAAAGATGTCTTATTGGATAGAG
ATAGTTGCACCCTCAACGGAGTGGACCAAGAACAAACCGATGCGATTCAT
AACGACTCTAATATGGAAATATTAACTGAGGAAGACTCAAGGCCATATAC
TTTTTTGCAAAACTTTAATTTCGTTGGCTTATGTGTTCTTTATAATTTTT
GCATGCTTTTAATTGTTCTGTCCATATACATCTACAAACGATGGAATTAA
AAGCTTTCTAGACCAT

BS33157.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 14:53:20
Subject Length Description Subject Range Query Range Score Percent Strand
CG44476-RA 234 CG44476-PA 1..234 17..250 1170 100 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 14:53:21
Subject Length Description Subject Range Query Range Score Percent Strand
CG44476-RA 290 CG44476-RA 45..280 17..252 1180 100 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 14:53:18
Subject Length Description Subject Range Query Range Score Percent Strand
2L 23513712 2L 18112840..18113071 252..21 1160 100 Minus
Blast to na_te.dros performed 2014-11-28 14:53:19
Subject Length Description Subject Range Query Range Score Percent Strand
HMS-Beagle 7062 HMS-Beagle Beagle 7062bp 1344..1391 216..169 105 68.8 Minus
Quasimodo 7387 Quasimodo QUASIMODO 7387bp Derived from P1 clones DS08479 & DS07153 by Sue Celniker, 29 March 2001. 6325..6371 203..254 105 71.2 Plus

BS33157.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.52.fasta performed 2014-01-22 13:27:21 Download gff for BS33157.complete
Subject Subject Range Query Range Percent Splice Strand
CG44476-RA 45..276 17..248 100   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 15:25:46 Download gff for BS33157.complete
Subject Subject Range Query Range Percent Splice Strand
CG44476-RA 45..276 17..248 100   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 15:25:46 Download gff for BS33157.complete
Subject Subject Range Query Range Percent Splice Strand
2L 18112844..18113072 17..248 98   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2014-01-22 13:27:21 Download gff for BS33157.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2L 18112844..18113072 17..248 98   Minus

BS33157.pep Sequence

Translation from 16 to 249

> BS33157.pep
MGEEKDVLLDRDSCTLNGVDQEQTDAIHNDSNMEILTEEDSRPYTFLQNF
NFVGLCVLYNFCMLLIVLSIYIYKRWN*

BS33157.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:55:10
Subject Length Description Subject Range Query Range Score Percent Strand
CG44476-PA 77 CG44476-PA 1..77 1..77 412 100 Plus