BS33157.complete Sequence
266 bp assembled on 2014-01-22
GenBank Submission: KX803464
> BS33157.complete
GAAGTTATCAGTCGACATGGGTGAAGAAAAAGATGTCTTATTGGATAGAG
ATAGTTGCACCCTCAACGGAGTGGACCAAGAACAAACCGATGCGATTCAT
AACGACTCTAATATGGAAATATTAACTGAGGAAGACTCAAGGCCATATAC
TTTTTTGCAAAACTTTAATTTCGTTGGCTTATGTGTTCTTTATAATTTTT
GCATGCTTTTAATTGTTCTGTCCATATACATCTACAAACGATGGAATTAA
AAGCTTTCTAGACCAT
BS33157.complete Blast Records
Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 14:53:20
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG44476-RA | 234 | CG44476-PA | 1..234 | 17..250 | 1170 | 100 | Plus |
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 14:53:21
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG44476-RA | 290 | CG44476-RA | 45..280 | 17..252 | 1180 | 100 | Plus |
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 14:53:18
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
2L | 23513712 | 2L | 18112840..18113071 | 252..21 | 1160 | 100 | Minus |
Blast to na_te.dros performed 2014-11-28 14:53:19
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
HMS-Beagle | 7062 | HMS-Beagle Beagle 7062bp | 1344..1391 | 216..169 | 105 | 68.8 | Minus |
Quasimodo | 7387 | Quasimodo QUASIMODO 7387bp Derived from P1 clones DS08479 & DS07153 by Sue Celniker, 29 March 2001. | 6325..6371 | 203..254 | 105 | 71.2 | Plus |
BS33157.complete Sim4 Records
Sim4 to dmel-all-transcript-r5.52.fasta performed 2014-01-22 13:27:21 Download gff for
BS33157.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG44476-RA | 45..276 | 17..248 | 100 | | Plus |
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 15:25:46 Download gff for
BS33157.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
CG44476-RA | 45..276 | 17..248 | 100 | | Plus |
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 15:25:46 Download gff for
BS33157.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
2L | 18112844..18113072 | 17..248 | 98 | | Minus |
Sim4 to na_arms.dmel.RELEASE5 performed 2014-01-22 13:27:21 Download gff for
BS33157.complete
Subject | Subject Range | Query Range | Percent | Splice | Strand |
arm_2L | 18112844..18113072 | 17..248 | 98 | | Minus |
BS33157.pep Sequence
Translation from 16 to 249
> BS33157.pep
MGEEKDVLLDRDSCTLNGVDQEQTDAIHNDSNMEILTEEDSRPYTFLQNF
NFVGLCVLYNFCMLLIVLSIYIYKRWN*
BS33157.pep Blast Records
Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:55:10
Subject | Length | Description | Subject Range | Query Range | Score | Percent | Strand |
CG44476-PA | 77 | CG44476-PA | 1..77 | 1..77 | 412 | 100 | Plus |