Clone BS33158 Report

Search the DGRC for BS33158

Clone and Library Details

Library:BS
Tissue Source:D. melanogaster
Created by:Joe Carlson
Date Registered:2004-06-03
Comments:Infusion clones with native stop reading frames
Original Plate Number:331
Well:58
Vector:pDNR-Dual
Associated Gene/TranscriptCG33785-RA
Protein status:BS33158.pep: gold
Sequenced Size:359

Clone Sequence Records

BS33158.complete Sequence

359 bp assembled on 2014-01-22

GenBank Submission: KX805835

> BS33158.complete
GAAGTTATCAGTCGACATGTTGTTTTTCTGCCCGTCGTGCGGAAATATAT
TGATTATCGAGGAAGACACCAACTGCCATCGCTTCACGTGCAACACCTGC
CCGTACATATCGAAGATCAGGCGCAAGATCTCCACGAAAACCTTTCCACG
CCTCAAGGAGGTGGATCACGTGCTGGGCGGCAAGGCGGCGTGGGAGAACG
TAGACTCCACGGACGCAGAGTGTCCAACGTGCGGCCATAAGCGGGCGTAC
TTTATGCAAATCCAGACGCGGTCGGCGGATGAGCCCATGACCACGTTTTA
CAAGTGCTGCAACCACGAGTGCAACCACACCTGGCGAGACTAAAAGCTTT
CTAGACCAT

BS33158.complete Blast Records

Blast to dmel-all-CDS-r6.02.fasta performed 2014-11-28 14:52:49
Subject Length Description Subject Range Query Range Score Percent Strand
CG33785-RA 327 CG33785-PA 1..327 17..343 1620 99.7 Plus
Blast to dmel-all-transcript-r6.02.fasta performed 2014-11-28 14:52:50
Subject Length Description Subject Range Query Range Score Percent Strand
CG33785-RA 1245 CG33785-RA 62..388 17..343 1620 99.7 Plus
CG33786-RA 1245 CG33786-RA 62..388 17..343 1620 99.7 Plus
Blast to na_all.dmel.RELEASE6 performed 2014-11-28 14:52:48
Subject Length Description Subject Range Query Range Score Percent Strand
2R 25286936 2R 20643323..20643510 343..156 940 100 Minus
2R 25286936 2R 20643583..20643724 158..17 695 99.3 Minus
Blast to na_te.dros performed on 2014-11-28 14:52:49 has no hits.

BS33158.complete Sim4 Records

Sim4 to dmel-all-transcript-r5.52.fasta performed 2014-01-22 13:27:08 Download gff for BS33158.complete
Subject Subject Range Query Range Percent Splice Strand
CG33785-RA 75..386 30..341 99   Plus
Sim4 to dmel-all-transcript-r6.02.fasta performed 2014-11-28 15:25:30 Download gff for BS33158.complete
Subject Subject Range Query Range Percent Splice Strand
CG33786-RA 75..386 30..341 99   Plus
Sim4 to na_all.dmel.RELEASE6 performed 2014-11-28 15:25:30 Download gff for BS33158.complete
Subject Subject Range Query Range Percent Splice Strand
2R 20643325..20643508 158..341 100 <- Minus
2R 20643584..20643711 30..157 99   Minus
Sim4 to na_arms.dmel.RELEASE5 performed 2014-01-22 13:27:08 Download gff for BS33158.complete
Subject Subject Range Query Range Percent Splice Strand
arm_2R 16530830..16531013 158..341 100 <- Minus
arm_2R 16531089..16531216 30..157 99   Minus

BS33158.pep Sequence

Translation from 16 to 342

> BS33158.pep
MLFFCPSCGNILIIEEDTNCHRFTCNTCPYISKIRRKISTKTFPRLKEVD
HVLGGKAAWENVDSTDAECPTCGHKRAYFMQIQTRSADEPMTTFYKCCNH
ECNHTWRD*

BS33158.pep Blast Records

Blast to dmel-all-translation-r6.02.fasta performed 2014-11-29 09:54:57
Subject Length Description Subject Range Query Range Score Percent Strand
CG33785-PA 108 CG33785-PA 1..108 1..108 621 100 Plus
RpII15-PC 129 CG3284-PC 20..129 4..108 157 30.9 Plus
RpII15-PB 129 CG3284-PB 20..129 4..108 157 30.9 Plus
RpII15-PA 129 CG3284-PA 20..129 4..108 157 30.9 Plus